KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350083
Entry
4350083           CDS       T01015                                 
Name
(RefSeq) methylthioribose-1-phosphate isomerase
  KO
K08963  methylthioribose-1-phosphate isomerase [EC:5.3.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4350083
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.23  S-methyl-5-thioribose-1-phosphate isomerase
     4350083
SSDB
Motif
Pfam: IF-2B
Other DBs
NCBI-GeneID: 4350083
NCBI-ProteinID: XP_015617957
UniProt: Q0ITU1
LinkDB
Position
11:6102857..6106533
AA seq 374 aa
MGELGALQSIVYHRGSLRLLDQRKLPLEVDYIDVKCSGDGWNAIRDMVVRGAPAIAIAAA
LALAVEVSGLEDFTGTPAEAAVFVSEKLEYLVSSRPTAVNLSDAATKLRSLVSRTAETEK
DAKAIFQAYIDAAETMLVDDVSDNKAIGSHGAEFLKQKLEVSKDISVLTHCNTGSLATAG
YGTALGVIRALHSGGILEKAFCTETRPFNQGSRLTAFELVHDKVPATLIADSAAAALMKS
GCIQAVIVGADRIAANGDTANKIGTYNLAISAKHHGVQFYVAAPITSIDLSLPSGEQIVI
EERSPNELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKSDADETFNI
KDFIQSAKLYSTMQ
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgggcgaattgggtgctctccagtccatcgtctaccaccgcggatcgctccgcctgctt
gatcagaggaagctcccactcgaggtggactacatcgacgtcaagtgctccggcgatgga
tggaacgcaatcagagacatggttgtccgtggcgctcctgcgattgccatagcagcggct
ttggctctggctgtagaggtttctgggttggaggatttcaccggtacgcctgcagaggca
gcagtttttgtttccgagaaattggagtaccttgtatcgagccgcccaactgcagtgaac
ctatctgatgctgcaaccaagcttcggagtttagtttcaaggacagcagaaactgagaaa
gatgccaaagcaatctttcaggcctacattgatgcagcagagaccatgctagttgacgat
gtgtcagataacaaggcaattggctctcatggagctgagtttctcaaacagaaacttgag
gtctctaaagatatttctgttctaacacactgtaatactggcagtcttgcgactgctggt
tatggaactgccttgggggttattcgtgctcttcactctggaggaattctagagaaggcc
ttttgcactgaaactcgtccatttaaccagggttccaggcttacagctttcgagttagtt
cacgacaaagtacccgcaacgctgatagcagattctgctgcagctgcactgatgaagagc
gggtgtattcaagctgtaatcgttggagctgatcgtatcgctgccaatggtgatactgct
aacaagattggcacatacaacctcgccatttctgcgaagcatcacggtgtgcaattctac
gtggctgcgccgataacttcgattgatctctccctcccatctggtgagcaaattgtgatc
gaagagaggtctcccaatgagttgctgaactctgaaggtggcctaggtaagcaagtcgcc
gcgtcaggtatatcggtgtggaaccctgccttcgatgttactccggcaaatctgattacc
gcaatcataacggaaaagggtgtgatcacaaagtctgatgctgatgagactttcaacatc
aaagatttcatccagtctgcaaaattgtactctaccatgcagtga

DBGET integrated database retrieval system