KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350089
Entry
4350089           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases I and III subunit RPAC2
  KO
K03020  DNA-directed RNA polymerases I and III subunit RPAC2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4350089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4350089
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     4350089
  RNA polymerase I system
   RNA polymerase I
     4350089
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Other DBs
NCBI-GeneID: 4350089
NCBI-ProteinID: XP_015617317
LinkDB
Position
11
AA seq 107 aa
MEHGTVEDSSASTFSIAEEEHTLANPARFVLNQDPRVAFCGYGVIPHPADNKVNIRVQTT
GDPAIDVFKDGLQDLIVMCQHVRGTFDNAVVDFRSKVPAQQMDIDSK
NT seq 324 nt   +upstreamnt  +downstreamnt
atggagcacgggacagtggaggactcgagcgcgtcgacgttctccatcgcggaggaggaa
cacaccctcgccaaccccgccagattcgtcctcaaccaggacccaagggtagcgttttgt
ggatatggggtcatccctcaccctgctgacaacaaagtcaacataagagttcagactaca
ggggatccagccattgatgtattcaaggatggtttacaggacttgatagtcatgtgccaa
catgttagagggacttttgacaatgcagtggtagattttagatcaaaggtacctgctcag
caaatggacatagattcaaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351715
Entry
4351715           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases I and III subunit RPAC2
  KO
K03020  DNA-directed RNA polymerases I and III subunit RPAC2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4351715
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4351715
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     4351715
  RNA polymerase I system
   RNA polymerase I
     4351715
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Other DBs
NCBI-GeneID: 4351715
NCBI-ProteinID: XP_015620219
UniProt: A0A8J8YBY3 Q2QWI0
LinkDB
Position
12:complement(4860234..4863213)
AA seq 108 aa
MEHGSVTDSTASTFSIVEEDHTLANSVRFVLNQDPRVAFCGYSIPHPADNKVNIRVQTTG
DPAKDVLKDSLQDLMVMCQHVRGTFDTAVTQFRQNNPTGMNIDQNKKK
NT seq 327 nt   +upstreamnt  +downstreamnt
atggagcatgggtcggtgacggactcgacggcctcgacgttctccatcgtggaggaggat
cacacgctcgccaactccgttagatttgttcttaatcaggacccaagggtagcattctgt
ggatacagtatccctcatcctgctgacaacaaagtcaacataagagttcagactacagga
gacccagcaaaggatgttctgaaagactctttgcaggatttgatggtgatgtgccagcat
gtaagggggacatttgacactgcagtgactcaatttcggcagaacaatcctacaggcatg
aacatcgatcagaacaaaaagaagtag

DBGET integrated database retrieval system