KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350524
Entry
4350524           CDS       T01015                                 
Name
(RefSeq) probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1
  KO
K16054  methylthioribulose 1-phosphate dehydratase / enolase-phosphatase E1 [EC:4.2.1.109 3.1.3.77]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4350524
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.77  acireductone synthase
     4350524
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.109  methylthioribulose 1-phosphate dehydratase
     4350524
SSDB
Motif
Pfam: Aldolase_II HAD_2 Hydrolase
Other DBs
NCBI-GeneID: 4350524
NCBI-ProteinID: XP_015617752
UniProt: Q2R483
LinkDB
Position
11:complement(17036985..17044164)
AA seq 518 aa
MACCGGGRGEGAAATESEAYLEGEAVREARELVAELCRHFYGQGWVTGTGGSITVKANDP
ALPLADQLIVMSPSGVQKERMVAEDMYVLSADGKVLSSPVSKPWPNKPPKCTDCAPLFMK
AYLMRGAGAVIHSHGMETCIATMLDPGAKEFRMTHMEMIKGIKGHGYRDELVVPIIENTP
YEYELTDSLAEAIAAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLYQLG
IDWTTPEHGPINSAKRPRSVLSSSIPNGCPDSKSSKHCVVLDIEGTTTPISFVTDVMFPY
ARDNVRKHLTSTYSSDETKEDIKLLRIQVEEDLKNGIVGSVPIPPDDADKEEVINALVAN
VESMIKADRKITSLKQLQGHIWRTGFESKELQGVVFDDVPEALKHWHASGMKVYIYSSGS
REAQRLLFGNTAYGDLRQYLCGFFDTTTGNKRETRSYFEISQSLGVDSPAQILFITDVFQ
EAVAAKSAGFEVIISIRPGNAPLPENHGFRTIKSFSEI
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggcgtgctgcggcggcggaaggggggagggggcggcggcgacggagtcggaggcgtac
ctggagggagaggcggtgagggaggcgcgggagctggtggcggagctgtgccgccacttc
tacggccaagggtgggtcaccggaacggggggcagcatcaccgtcaaggccaacgacccg
gcgctccccctcgccgatcagctcatcgtcatgtccccctccggtgtgcagaaggagagg
atggtggcagaggacatgtatgtgctgtcagcagatgggaaggtgctctcctcacctgta
tcaaagccatggccaaacaagcctccaaaatgtactgactgtgctcctctgttcatgaag
gcttatctgatgagaggagctggggctgttattcatagccatgggatggaaacttgcatt
gcaaccatgcttgatcctggtgcaaaagagtttaggatgacacatatggaaatgattaaa
ggaattaaaggccatggttaccgtgacgaattggtggttcctataattgagaacactcct
tatgagtatgagctcactgactcactggctgaggcgattgcagcataccctaaggcaact
gcagtccttgtacggaaccatggaatttatgtatggggtgattcctggatcaatgccaag
acacaggctgaatgctatcattacctttttgatgctgccatcaagctctatcaattgggt
attgattggacaactcctgagcatggtccaataaacagtgccaaaagaccacgcagtgtt
ctaagctctagtattccaaatggatgccctgattccaaatcatcaaagcattgtgttgtt
cttgacattgagggaacaactactccaatatcatttgtgactgatgtgatgtttccctat
gcccgtgataatgtgcgaaagcatctgacttcaacatatagttctgatgaaaccaaagag
gacatcaaactattgcgcatccaagttgaagaagacctgaaaaatggaattgttgggtct
gttccaattccacctgacgatgctgacaaagaagaggttatcaatgcattagttgctaat
gttgaatcgatgattaaagcagacaggaagattacgtcgttgaaacaactccagggccac
atatggaggactggttttgaaagtaaagaactgcaaggagttgttttcgatgatgtcccc
gaggcgctaaagcactggcatgctagtggcatgaaggtctacatatactcaagtggcagc
cgggaggcgcaaaggctattatttggcaatacggcctatggtgatctgcgacaatacctc
tgtggtttctttgacaccacaaccggtaacaaaagagaaacaaggagctactttgagatt
tcgcaatcacttggggtggacagtcctgctcagatcttatttatcaccgatgtcttccaa
gaagctgttgctgcaaaaagtgcaggttttgaggtaataatctccattcgcccgggaaat
gcaccgctccctgagaatcatggtttccggactatcaagtcgtttagtgagatctga

DBGET integrated database retrieval system