KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350758
Entry
4350758           CDS       T01015                                 
Name
(RefSeq) prolycopene isomerase 1, chloroplastic
  KO
K09835  prolycopene isomerase [EC:5.2.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00906  Carotenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00097  beta-Carotene biosynthesis, GGAP => beta-carotene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    4350758
Enzymes [BR:osa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.13  prolycopene isomerase
     4350758
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 FAD_oxidored Thi4 GIDA HI0933_like FAD_binding_3 GDI GMC_oxred_N
Other DBs
NCBI-GeneID: 4350758
NCBI-ProteinID: XP_015617022
LinkDB
Position
11:21485798..21490276
AA seq 641 aa
MWGPPLRLIRRALVFPPLTSTTSRGGILSLQIPPRPLLPYKNPTQLELPRFTGAAMPLLL
LAAARPCAPLLAPSAAGAVVGRPSTARPLGRGTRRGAGAAAAAAVAAEKTVVKAEEEEEG
GGEYDAIVVGSGIGGMVAATQLAAKGARVLVLEKYVIPGGSSGYYRRDGFTFDVGSSVMF
GFSDKGNLNLITQALEAVGHKMEVIPDPSTVHFHLPGDLSVLVHREYDDFVTELVNKFPH
EKEGILKFYGTCWKIFNSLNSLELKSLEEPLYLFGQFFQKPLECLTLAYYLPQNAGDIAR
KFIKDQQLLSFIDAECFIVSTVNALQTPMINASMVLCDRHFGGINYPVGGVGGIAMSLAD
GLVDKGSEIRYKANVTNVILENGKAVGVRLSNGKEFFAKTVISNATRWDTFGKLLKVEEL
PEEEKNFQKNYVKAPSFLSIHMGVKASVLPADTDCHHFVLEDDWANLEKPYGSIFLSIPT
VLDPSLAPEGHHILHIFTTAGIEDWEGLSRKDYEKKKELVATEIIKRLEKKLFPGLQDSI
VLKEVGSPKTHRRFLARNDGTYGPMPRGKPKGLLAMPFNTTSIDGLYCVGDSCFPGQGVI
AVAFSGIMCAHRVAADIGLEQRSPVLDAGLLGLLRWLRTLA
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgtggggccccccacttcgcctcatccgccgcgccctcgtcttccctccactaacctcc
accacctcccgcggcggaatcctctcgctgcagattccaccgcggcctctcctcccatat
aaaaaccccacccagctcgagctcccgcgcttcaccggcgccgccatgccgctcctcctc
ctcgccgccgcgcgcccgtgcgccccgctcctcgctccctccgccgccggagcagtagta
ggccggccgtccaccgcccgcccactgggacgagggaccaggagaggcgcgggcgcggcg
gcggcggctgcggtggcggcggagaagacggtggtgaaggcggaggaggaggaggagggt
gggggagagtacgacgcgatcgtggtggggtcggggatcggggggatggtggcggcgacg
cagctggcggcgaagggggcgagggtgctggtgctggagaagtacgtcatccccgggggg
agctccgggtactaccgccgcgacgggttcaccttcgacgtcggctcctccgtcatgttc
ggcttctccgacaaggggaacttgaatttgattacacaagcactagaagcagttgggcat
aagatggaagttataccggatccttctacggttcatttccacctacctggtgacctctca
gttcttgtgcatagagagtatgatgacttcgtcacggagctggttaataaatttcctcat
gaaaaggaaggaatcctgaaattctatggcacatgttggaagatcttcaattcattaaat
tctttggagctgaagtcccttgaggagcctctatatctttttgggcaattttttcaaaag
cctctggaatgtttgacgctagcttattatctgccacagaatgctggggatattgctcgc
aagttcataaaagatcagcagttactctccttcatagatgctgagtgctttattgtgagc
acagtcaatgccttgcaaacacccatgattaatgcaagcatggtcttgtgcgataggcac
ttcgggggaattaactatccagttggtggtgttggtggtattgctatgtccttggcagat
gggcttgttgacaaaggcagtgaaatacgctacaaggctaatgtgaccaatgtaatttta
gaaaatggcaaagctgttggagtcaggttatcaaatgggaaggagttctttgctaaaaca
gtgatatcgaatgctaccagatgggatacatttggtaaactcttgaaagttgaagagctt
ccagaagaggagaaaaacttccaaaagaattatgttaaagcaccatcattcctttccatt
catatgggtgtcaaagcctcagttttgcctgctgatactgattgccaccattttgtactt
gaggatgactgggctaatttggagaagccttatggaagcatatttttaagtatccctaca
gtgcttgacccatccttggctcccgaaggacaccatatacttcatatttttacaactgca
gggatagaggattgggaaggtctgtccaggaaggattatgagaagaaaaaggagcttgtg
gcgacagagataataaagaggcttgaaaaaaagctgttccctggtcttcaggattcaata
gtcctcaaggaggtaggctcaccaaaaacacaccgaagatttcttgcgcgaaatgatggt
acatatggacccatgccacggggtaaaccaaagggattgctagcaatgcctttcaatact
acttcaatagatggcttgtactgtgttggcgacagctgttttcctgggcaaggtgtaatt
gctgtggcattttcagggatcatgtgtgctcatcgagttgcagctgatattggactggaa
caaagatctcctgtactagatgcgggtcttcttgggctcctcagatggttgagaacgctt
gcttag

DBGET integrated database retrieval system