KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350923
Entry
4350923           CDS       T01015                                 
Name
(RefSeq) DNA repair protein RAD51 homolog A
  KO
K04482  DNA repair protein RAD51
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4350923
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4350923
   04121 Ubiquitin system [BR:osa04121]
    4350923
   03400 DNA repair and recombination proteins [BR:osa03400]
    4350923
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    4350923
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    4350923
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     4350923
    RecA family proteins
     4350923
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     4350923
SSDB
Motif
Pfam: Rad51 RecA AAA_25 ATPase HHH_5 DnaB_C AAA_22 ssDNA_TraI_N
Other DBs
NCBI-GeneID: 4350923
NCBI-ProteinID: XP_015617774
UniProt: A0A8J8XX61 Q8SBB9
LinkDB
Position
11:23942674..23946590
AA seq 339 aa
MSTSAAASAAAEQQQEEGEHGPFPIEQLQASGIAALDVKKLKDSGLYTVESVAYTPRKDL
LQIKGISEAKVDKIVEAASKLVPLGFTSASQLHAQRLEIIQVTTGSRELDKILDGGIETG
SITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGL
NGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALMIVDSATALYRTDFSGRGELSA
RQMHMAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAMFAGPQIKPIGGNIMAHASTTRL
ALRKGRGEERICKVISSPCLAEAEARFQIASEGVADVKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtcgacgtcggcggcggcgtcggcggcggcggagcagcagcaggaggagggggagcac
gggccgttccccatcgagcagctgcaggcatctggaattgctgctctggatgtgaaaaag
ctcaaggattctggtctgtacacagtggagtctgtggcctatactccaaggaaagacctt
ttgcaaatcaaaggaattagtgaagccaaagttgacaagatagttgaagcagcatcgaag
ctagtcccattgggatttacaagtgcgagccaacttcatgcacaaaggctggagattatt
caagttacaactggatctagagagcttgataagattttggatggggggatagaaactggc
tctatcacagagatttatggtgaattccgatcagggaagactcagctgtgccacacgctg
tgtgtcacatgtcagcttccattggaccaaggtggtggtgaagggaaggctttgtacatt
gatgcagagggaacattcagaccacaaaggctgctccagatagctgacaggttcgggttg
aatggtgctgatgtattagagaacgtggcttatgccagagcttataatactgatcatcaa
tcaagacttctgctggaggcagcttccatgatgatagagactaggtttgctctcatgatt
gtagacagcgcgacagctttgtacagaactgatttctcaggtcgaggggagctctcagcg
aggcaaatgcacatggctaagtttctgaggagccttcagaaattagcagatgagtttgga
gtggctgtggttatcactaatcaagtagtggcacaagtggatggttctgccatgtttgct
gggccgcagatcaaacccatcggtggaaacatcatggctcatgcttccacaacaaggctt
gctcttcgcaagggaagaggggaagagcgaatatgtaaagtgataagctctccatgcttg
gctgaagccgaagcaaggtttcagatagcatctgaaggcgttgcagatgtcaaggattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352257
Entry
4352257           CDS       T01015                                 
Name
(RefSeq) DNA repair protein RAD51 homolog B
  KO
K04482  DNA repair protein RAD51
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4352257
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4352257
   04121 Ubiquitin system [BR:osa04121]
    4352257
   03400 DNA repair and recombination proteins [BR:osa03400]
    4352257
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    4352257
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    4352257
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     4352257
    RecA family proteins
     4352257
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     4352257
SSDB
Motif
Pfam: Rad51 RecA AAA_25 ATPase HHH_5 DnaB_C ssDNA_TraI_N PAXNEB
Other DBs
NCBI-GeneID: 4352257
NCBI-ProteinID: XP_015619428
UniProt: Q8RV34 Q0IN90
LinkDB
Position
12:18876056..18879209
AA seq 341 aa
MSSSGAAAAAAATAEEAAAGGEHGPFPIEQLQASGIAALDVKKLKDAGLCTVESVVYSPR
KDLLQIKGISEAKVDKIIEGASKLVPLGFTSASQLHAQRLEIIQVTTGSRELDKILDGGI
ETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADR
FGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFAIMIVDSATALYRTDFSGRGE
LSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGAAMFGPQIKPIGGNIMAHASTT
RLFLRKGRAEERICKVVSSPCLAEAEARFQISPEGVTDVKD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcgggtgcggctgcggcggcggcggcgacggcggaggaggcggcggcgggc
ggggagcacgggccgttccccatcgagcagctccaggcatctggtatagctgcacttgat
gtgaaaaagctcaaagatgctggtctctgcacggtggagtctgtggtctactcaccaagg
aaagaccttctgcaaattaaagggattagtgaagccaaagtcgataagataattgaagga
gcttcgaagctggttccactgggatttacaagtgccagccaacttcatgcacagagactt
gagattatccaagttacaactggatcaagggaacttgataaaatcttggatggtggaata
gaaactgggtccattacagagatatatggtgaatttcgctcagggaagactcagttgtgc
cacactctgtgtgttacatgtcagctcccattggaccaaggtggtggtgagggaaaagct
ttgtatattgatgcagagggcacattcagaccacaaagactcctccagatagcagacagg
tttgggttgaatggtgctgatgtacttgagaatgtagcttatgcaagagcatataatact
gatcatcaatcaagacttttactggaagcagcttccatgatggtggagacaaggtttgct
attatgattgtagatagtgcaacagccttatacagaacagatttctctggtagaggggag
ctgtcagcaaggcaaatgcacctggccaagtttcttaggagccttcagaagttagcggat
gagtttggcgtggcggtggtaatcacgaatcaagttgtggcgcaagtggatggtgctgca
atgtttgggccacagatcaaacctatcggcgggaacatcatggctcatgcttccacaaca
aggctttttcttcgaaagggaagagcggaggagcggatatgtaaggtagtaagctctccc
tgtcttgctgaagctgaggcgaggtttcagatatcaccggaaggcgtcacagatgttaag
gactga

DBGET integrated database retrieval system