KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350961
Entry
4350961           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 26A
  KO
K18466  vacuolar protein sorting-associated protein 26A/B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4350961
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4350961
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    4350961
SSDB
Motif
Pfam: Vps26 Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 4350961
NCBI-ProteinID: XP_015618019
UniProt: A0A8J8YHU0 Q2R0X0
LinkDB
Position
11:24642523..24646958
AA seq 304 aa
MNYIIGAFKAPCDVFITFADERSRKQVAIKKDNGKTLMVPAFQSLETIAGEVSVAPVPGK
RVEHQGVKIELLGQIELYHERGHFYDFTSLVRELEVAGEIYERKTYPFEFSTVEMPYESY
NGTNVRLRYILKVTIGRPYATSVVECRDFCVRNYTPLPSINNSIKMEVGIEDCLHIEFEY
SKSKYHLKDVIVGKIYFLLVRIKIKNMELEIRRRESTGSGPGTYIETETLAKFELMDGAP
VRGESIPVRLFLTPYELTPTYRNINNKFNVKYYLNLVLVDEEDRRYFKQQEITMYRLQET
PQSS
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaattacatcatcggagcattcaaggcgccctgcgacgtcttcatcaccttcgccgat
gagaggagccggaagcaggtggcgatcaagaaggataacgggaagacgttgatggtgccg
gccttccagagcctggagactattgcaggagaggtgtcggtagcgcccgttccaggtaaa
agggtggagcaccaaggtgtcaagattgagctgctgggtcagatagagctgtaccatgag
agaggtcacttctatgacttcacttcgttagtgcgagagttagaggttgctggtgaaatc
tatgaaaggaagacttatccatttgaattctctactgttgagatgccttatgagtcgtat
aacggaacaaatgtcagattgaggtacatcctgaaagttacaattggcagaccatatgct
actagtgttgtggaatgtcgagatttctgtgtaaggaattacactcctcttccttcaatt
aacaatagcatcaagatggaagttggaattgaagattgtttgcatattgaatttgagtac
agcaaaagcaagtaccatctcaaggatgtgatcgtgggaaaaatctattttcttctagtc
agaataaagataaagaacatggagcttgagattcgtcggcgggaatcaacaggatctggg
cctggcacatatattgagactgagacacttgcaaagtttgagttgatggatggcgctccc
gtaagaggtgagtctattccggtaagactcttcttgacaccatatgagttgaccccgact
taccgcaacataaacaacaagttcaatgtcaagtactacctgaacctggttcttgttgac
gaggaagaccggaggtacttcaagcagcaagagatcacaatgtaccgccttcaagaaact
ccgcaatcttcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352271
Entry
4352271           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 26A
  KO
K18466  vacuolar protein sorting-associated protein 26A/B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4352271
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4352271
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    4352271
SSDB
Motif
Pfam: Vps26 Arrestin_C
Other DBs
NCBI-GeneID: 4352271
NCBI-ProteinID: XP_015618464
UniProt: Q2QQB3 A0A8J8Y734
LinkDB
Position
12:19055692..19060938
AA seq 306 aa
MNYIVGAFKPPCDISIAFSDARSRKQIAVKNDNGRTVMVPVFQSLETISGEVSVVPVPGK
RIEHLGVKIELLGQIELYLERGKFYDFTSLVRELDIPGEIYEKKTYPFEFSTVEMPYESY
NGTNVRLRYILKVTISRNIMGMGSIVEFREFCVRNYSPAPTINNSIKMEVGIEDCLHIEF
EYSKSKYHLKDVIIGKIYFLLVRIKIKNMELEVRRRESTGAGSSAYVETETLAKFELMDG
APVRGESIPVRLFLTPYELTPSYRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITMYRLL
ETPQAS
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaactacatcgtcggagcgttcaagccgccctgcgacatctccatcgccttctccgac
gccaggtcgcggaagcagatcgcggtcaagaatgacaatgggaggacggtgatggtgccg
gtcttccagagcctggagaccatatccggggaggtgtcggtagtgccggttccgggcaag
aggatcgagcacttgggtgtcaagattgagttactgggtcagatagagctttatttggag
cgaggcaaattctatgacttcacttcattggtgcgtgagctagatattcctggtgaaatt
tacgagaagaaaacatatccattcgagttttccactgttgaaatgccttatgaatcttac
aatggaacaaatgtcagattaagatatattttgaaggttacgatcagccgaaacattatg
ggcatgggcagcattgtggagttccgtgagttctgtgtaagaaattactctcctgccccc
acaatcaacaacagtatcaagatggaagttggaattgaggattgcttacatattgagttc
gaatacagcaaaagcaagtaccatctcaaggatgtgattattgggaagatctactttctt
cttgtcagaataaagataaaaaacatggaactagaagtacgtcgtagggaatcaacagga
gcaggctctagtgcatatgttgagactgaaactcttgcaaagtttgagttgatggatggt
gctcctgtcagaggagaatccatcccggtgaggctattcttgacgccttacgagctgacc
ccttcgtatcggaacataaacaacaagttcagcgtcaagtactacctgaatctggtcctt
gttgatgaggaagataggaggtacttcaagcagcaagagatcaccatgtatcgccttcta
gaaaccccccaggcttcctag

DBGET integrated database retrieval system