KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350964
Entry
4350964           CDS       T01015                                 
Name
(RefSeq) phosphoserine phosphatase, chloroplastic
  KO
K01079  phosphoserine phosphatase [EC:3.1.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4350964
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4350964
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     4350964
Protein phosphatases and associated proteins [BR:osa01009]
 HAD phosphatases
  Other HAD phosphatases
   4350964
SSDB
Motif
Pfam: HAD Hydrolase Hydrolase_3 HAD_2
Other DBs
NCBI-GeneID: 4350964
NCBI-ProteinID: XP_015615356
UniProt: Q2R0W7 Q0IRI7
LinkDB
Position
11:complement(24655899..24659358)
AA seq 296 aa
MAGVISARAGLSHSLSVTQTVPNRPLQASQLATRCTSPSFLSAKLCKTRPLVVVAAMEVS
KEAPSADFANRQPSKGVLETWCNADAVCFDVDSTVCLDEGIDELADFCGAGKAVAEWTAK
AMTGTVPFEEALAARLSLIKPYLSQVDDCLVKRPPRISPGIADLIKKLKANNTDVFLVSG
GFRQMIKPVASELGIPPENIIANQLLFGTSGEYAGFDPTEPTSRSGGKALAVQQIRQNHG
YKTLVMIGDGATDLEARQPGGADLFICYAGVQMREAVAAKADWVVIDFQELISELP
NT seq 891 nt   +upstreamnt  +downstreamnt
atggctggtgtgatcagcgcccgtgctggtctgagccattccttgtctgttactcagaca
gttccgaatcgtccgctgcaggcttcacaattggcaacgaggtgtacaagcccatcattt
ctttctgctaaactttgcaagactcgtcccctggtagtagtagcagctatggaggtctcg
aaggaagccccttctgctgactttgccaatcgccagccttccaaaggggttcttgagaca
tggtgcaatgccgatgcagtgtgttttgatgttgatagcacggtctgcttggatgagggt
attgatgaactcgctgatttctgtggggctgggaaggctgttgctgagtggactgcaaag
gcaatgacaggaactgttccatttgaggaggcactagctgccaggctatcgttaattaag
ccatatctgtcccaagttgatgactgtttagtgaagaggcctccaaggatttctcctgga
attgctgacttgattaagaagctcaaagcaaataatactgatgtattccttgtgtcagga
ggttttcgacaaatgatcaagcctgtggcatctgagcttggcattcctcctgaaaacatc
attgcaaaccaacttctttttggaacatctggagagtatgctggatttgatcccactgaa
cccacttcacgaagtgggggtaaagcactagcagtccaacaaattagacagaaccatggt
tataagacacttgttatgattggagatggtgcaactgatcttgaggctcggcagcctgga
ggagcagacttgttcatctgttacgcaggtgtccagatgagagaagcagttgcagcaaaa
gcagattgggttgtcatcgattttcaagaactaatttcagaattgccataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352281
Entry
4352281           CDS       T01015                                 
Name
(RefSeq) phosphoserine phosphatase, chloroplastic
  KO
K01079  phosphoserine phosphatase [EC:3.1.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4352281
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4352281
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     4352281
Protein phosphatases and associated proteins [BR:osa01009]
 HAD phosphatases
  Other HAD phosphatases
   4352281
SSDB
Motif
Pfam: Hydrolase HAD Acid_phosphat_B
Other DBs
NCBI-GeneID: 4352281
NCBI-ProteinID: XP_015619367
UniProt: B9GDA6 Q2QQ95
LinkDB
Position
12:complement(19147266..19151000)
AA seq 295 aa
MAKMVSQCISPRQSFRVPRFSSARPTLSSRLAIGYANPSFCGVKRSNRPSFIAAALDVPK
SMSSPNSESSLPLKEVIWAWCNADAVCFDVDSTVCLDEGIDELADFCGAGQAVAEWTAKA
MTGSVPFEKALAARLSLFKPSLGQVEDCMEKRPPRISPGIAELVKMLKAKNVDVYLVSGG
FRQMIKPVAMQLGIPPENIFANQLLFGTSGEYVGFDPSEPTSRSGGKAVAVQNIRQKCGY
RTLFMVGDGATDLEARQPNGADLFICYAGVQMREAVASKADWLIFDFDELMGYLV
NT seq 888 nt   +upstreamnt  +downstreamnt
atggccaaaatggttagtcagtgtatctctccgcggcagtcctttcgcgttcctcgtttt
tcatcagctcggcctacgctaagttcacgtttagcaattggctacgccaacccgtcgttt
tgcggtgttaaacgctcaaatcgtccgagttttatagcagcagcactggatgtaccaaaa
agtatgtcctcccctaattcagagagctccctgcctttgaaagaggttatctgggcatgg
tgcaatgctgacgcggtgtgcttcgatgttgacagcacggtctgcttggacgagggtatc
gatgagctcgcggacttctgtggggcaggccaagcggttgctgaatggacggctaaggcg
atgactgggtcagttccgtttgaaaaggcattagctgctcggctatcgttgttcaagcca
tctttggggcaagttgaggactgcatggagaagcggccaccaagaatatctcctggaatt
gctgagcttgttaagatgctgaaagctaaaaatgttgatgtgtacctggtttctggaggc
ttccgacagatgatcaagcctgttgcaatgcagctcggcattcctcctgaaaatattttt
gcaaaccagttactgtttggaacttctggagagtatgttggttttgacccttcagagcct
acttcacgaagtggaggcaaagctgtagcagttcaaaacataagacagaagtgtggttac
aggacactctttatggttggagatggtgcaactgatcttgaggctcggcaacctaatgga
gcagacttgtttatctgctatgctggtgtgcagatgagggaagcggttgcatcaaaagcc
gattggttgatctttgattttgacgaactaatgggctatttggtttag

DBGET integrated database retrieval system