KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350976
Entry
4350976           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S29
  KO
K02980  small subunit ribosomal protein S29e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4350976
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4350976
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4350976
SSDB
Motif
Pfam: Ribosomal_S14
Other DBs
NCBI-GeneID: 4350976
NCBI-ProteinID: XP_015615419
UniProt: Q7XZX4 C7IZH8
LinkDB
Position
11:24973654..24975325
AA seq 56 aa
MGHSNVWNSHPKNYGPGSRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIKYR
NT seq 171 nt   +upstreamnt  +downstreamnt
atgggccactccaacgtgtggaactcccaccccaagaactacgggcccggctcccgcgtc
tgccgggtctgcgggaaccctcatgggctgatcaggaagtatgggctcatgtgctgcagg
cagtgcttccgcagcaacgccaaggatattggcttcatcaagtaccgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352308
Entry
4352308           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S29
  KO
K02980  small subunit ribosomal protein S29e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4352308
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4352308
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4352308
SSDB
Motif
Pfam: Ribosomal_S14
Other DBs
NCBI-GeneID: 4352308
NCBI-ProteinID: XP_015618195
UniProt: Q7XZX4 C7IZH8
LinkDB
Position
12:19536616..19538388
AA seq 56 aa
MGHSNVWNSHPKNYGPGSRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIKYR
NT seq 171 nt   +upstreamnt  +downstreamnt
atggggcactccaacgtgtggaactcccaccccaagaactacgggccgggctcccgcgtc
tgccgggtgtgcgggaaccctcatggactgatcaggaagtacgggctcatgtgctgcaga
cagtgcttccgcagcaacgccaaggacatcggcttcatcaagtaccgctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267266
Entry
9267266           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S29
  KO
K02980  small subunit ribosomal protein S29e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9267266
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9267266
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    9267266
SSDB
Motif
Pfam: Ribosomal_S14
Other DBs
NCBI-GeneID: 9267266
NCBI-ProteinID: XP_015632483
UniProt: Q7XZX4 C7IZH8
LinkDB
Position
3:complement(32041623..32043447)
AA seq 56 aa
MGHSNVWNSHPKNYGPGSRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIKYR
NT seq 171 nt   +upstreamnt  +downstreamnt
atgggacactccaacgtgtggaactcgcaccccaagaactacggccccggatccagggtt
tgccgtgtttgcggcaacccgcatggcttgatccggaagtacgggctcatgtgctgcagg
cagtgcttccgcagcaacgccaaggacattggcttcatcaagtaccgttga

DBGET integrated database retrieval system