KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351008
Entry
4351008           CDS       T01015                                 
Name
(RefSeq) glutathione synthetase, chloroplastic isoform X1
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4351008
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4351008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4351008
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     4351008
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4351008
SSDB
Motif
Pfam: GSH_synth_ATP GSH_synthase Phage_Gp111
Other DBs
NCBI-GeneID: 4351008
NCBI-ProteinID: XP_015615075
UniProt: Q0IRE6 A0A0P0Y4V3
LinkDB
Position
11:25492167..25496872
AA seq 540 aa
MSSYVTTPHHHHHHGCCSGSRRLQAPAPPARPRLVVAAAARHVALPPRRAVASRAMSAEA
PLGVAPAAAEEEMAAVVDEMAEEAAVWCAVHGLVVGDRAEPRSGTIPGVGLVHAPFALLP
TRFPASFWKQARELAPIFNDLVDRVSLDGEFLQDSLSRTRQVDDFTSRLLDIHAKMMEVN
KEEDIRLGLHRSDYMLDSGTNSLLQIELNTISSSFPGLSSLVSELHRTLLNRHGKVLGLD
SKRIPQNWAATQFAEALSMAWTEFNNKSAVIMMVVQPEERNMYDQYWLINHLKESHGVKT
IRKTLAQVEAEGQVLPDGTLVVDGQTVSVVYFRAGYSPNDYPSEAEWRARLLMEQSSAIK
CPSISYHLVGTKKIQQELAKPNILERFLNNKEDIAKLRKCFAGLWSLDNEEIVKTAIEKP
DLFVLKPQREGGGNNIYGYDLRETLVRLQKEQGEALAAYILMQRIFPRASLTHLVQGGVC
FEDLTISELGIFGAYLRNKDKVVLNNQCGYLMRTKVSSSNEGGVAAGFAVLDSILLTDEW
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtcctcctacgtcaccaccccccaccaccaccaccaccatggctgctgctccggcagc
cgccgcctccaggcaccggcgcctcccgcccgcccccgcctcgtcgtcgccgccgccgcg
agacacgtggccctccccccccgccgcgcggtggcctcgagggcgatgagcgccgaggcg
cccctgggtgtcgcgccggcggcggcggaagaggagatggcggcggtggtggacgagatg
gcggaggaggccgccgtctggtgcgccgtgcacgggctcgtcgtcggcgaccgcgcggaa
ccgagatcaggaactattcctggtgttggtctggttcatgctccatttgcgttacttcca
acacgttttccagcatctttttggaagcaagcacgtgaactggctcctattttcaatgat
cttgtggatcgtgtgagcttggatggcgagtttttgcaagactccttatctagaacaaga
caagttgatgatttcacttctaggctcttagacattcatgcgaagatgatggaagtaaat
aaggaggaggatatccgtttagggttgcatcgatctgattacatgctggattctggaacc
aattcacttctccaaattgagctcaacactatttcatcatcatttcctggtcttagttcc
cttgtaagcgaacttcacaggaccctacttaatcgacatggcaaggttttaggccttgat
tccaaaaggattcctcagaactgggctgccacccaatttgctgaagcattgagcatggct
tggactgagtttaataacaagagtgctgtaattatgatggttgttcaacctgaagaaaga
aacatgtatgaccaatactggcttatcaatcatttgaaggaatcgcatggtgtgaagacc
attaggaaaacattggcacaggtagaggctgaagggcaggttcttccagatggaacgctt
gtggtagacggacagacagtttctgttgtgtatttcagagctggatattctccaaatgat
tatccttctgaagcggaatggagagccaggcttttgatggagcagtcatctgctataaag
tgcccttcaatatcctaccatttagtgggaacgaaaaagatccagcaagaactagcaaaa
cctaatattcttgaaagattccttaacaacaaggaggacattgccaagctacggaaatgc
tttgcaggcttatggagtttagataatgaagaaatagtgaagactgcaatagaaaaacct
gacttgtttgtcctgaaacctcagcgagaaggcggaggaaacaacatatatggttatgat
ctgcgagaaacgctggtcagactccagaaggagcagggagaggcacttgcagcctacata
ctgatgcaaaggatttttccaagagcttctcttactcatctggtccagggtggcgtttgc
tttgaggaccttacaatatctgagcttgggatatttggagcctatttgcggaacaaagat
aaggtagtcctgaataatcagtgtggttacttgatgcgcaccaaagtttcttcatcaaac
gaaggtggagttgctgcaggatttgctgttctggatagtattctcctcacagatgagtgg
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272324
Entry
9272324           CDS       T01015                                 
Name
(RefSeq) glutathione synthetase, chloroplastic isoform X1
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    9272324
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    9272324
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9272324
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     9272324
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9272324
SSDB
Motif
Pfam: GSH_synth_ATP GSH_synthase
Other DBs
NCBI-GeneID: 9272324
NCBI-ProteinID: XP_015618060
LinkDB
Position
12:20838395..20843236
AA seq 502 aa
MSAAAEGRPPAAAAAGEMVREATAWCALHGLVVGDRADPVTPLLLLIWFHKSQAPPSRLH
GERSGTVPGVGLVHAPFSLLPTHLPESHWRQACELAPIFNELVDRVSLDGDFLQDSLSKT
KQVDDFTSRLLEIHRKMMEINKEENIRLGLHRSDYMLDSETNSLLQIELNTISASFPGLG
SLVSELHRTLIDQYGHLFCLDSKRVPGNEASSQFAKALARAWDEFNVDSAVIMMIVQPEE
RNMYDQYWLAKHLKESHGITTIRKTLSEVEAEGHVLPDGTLVIDGKTVSVVYFRAGYTPN
DYPSEAEWAARLLLEQSSAVKCPSISYHLVGTKKIQQELARPNVLERFLENKEEITKIRK
CFAGLWSLDDEEIVKSAIQKPELFVLKPQREGGGNNIYGIDVRETLIRLQKEGGDALAAY
ILMQRIFPKASLSNLVRGGVCHEALTISELGIYGAYLRNNDKVVMNEQSGYLMRTKVSSS
DEGGVAAGFAVLDSLYLTDKAM
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgagcgccgccgcggaggggaggccgccggcggcggcggcggcgggtgagatggtgcgg
gaggccaccgcgtggtgcgcgctgcacgggctcgtcgtcggcgaccgcgccgaccctgta
acgcctcttctcctcctaatttggtttcacaaatcgcaagcgcctccctctcgcctccat
ggagagcgatctggaacagtccccggcgttggtttggttcatgctcctttctctctgctc
ccaacgcatcttccagaatctcattggaggcaggcgtgcgagttggctcctatttttaac
gagcttgtggatcgtgttagcttggacggggacttcttgcaagattctttgtctaaaaca
aagcaagttgacgatttcacttctaggctgttagagattcataggaagatgatggaaata
aataaggaggagaatatccggttggggttgcatcggtcagactatatgcttgattcagag
accaattctcttcttcaaatagagctcaacactatttcagcatctttccctgggcttggt
tccttagtaagtgagcttcacaggaccttaattgatcagtatggacacttattttgtcta
gactccaagagggttcctggaaatgaggcaagcagtcaatttgctaaagcattggccaga
gcatgggatgagtttaatgttgacagtgctgtaattatgatgattgttcagcccgaagaa
agaaatatgtatgaccagtactggctcgccaaacatttgaaggaatcacatggcataacg
actatcaggaaaactttgtcagaggtagaggctgaaggccacgttctcccagatggaaca
cttgtcatagatggcaagacagtttctgtggtgtacttcagagctggctatacaccaaat
gattatccttcagaagcagaatgggctgcaaggctattgctggaacaatcatctgctgta
aagtgcccttcgatatcataccatttagtggggaccaagaagattcaacaagaattagca
agacctaatgttcttgaaaggtttcttgaaaacaaggaggaaatcacaaagatccgtaaa
tgctttgcaggactatggagcttggatgatgaagagattgtgaaatccgcaatccaaaaa
cccgagttgtttgtcttgaagccccaacgtgaaggcggagggaacaacatatacggtatt
gatgtacgagagactttgatcagactccagaaggaaggaggggatgcgcttgcagcctac
atactgatgcaaagaatcttcccaaaagcctctctctctaatctggttcgtggtggtgtt
tgccatgaggccctcacaatatctgagcttggaatttatggtgcttacttgcggaacaat
gataaggtggttatgaatgaacagagtggttacttgatgcggacaaaagtttcatcgtca
gatgaaggtggcgttgctgcaggatttgctgttttggatagtttgtacttaaccgacaag
gcgatgtag

DBGET integrated database retrieval system