KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351127
Entry
4351127           CDS       T01015                                 
Name
(RefSeq) beta-glucosidase-like SFR2, chloroplastic
  KO
K21362  galactolipid galactosyltransferase [EC:2.4.1.184]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4351127
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4351127
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.184  galactolipid galactosyltransferase
     4351127
Glycosyltransferases [BR:osa01003]
 Glycan extension
  Glycolipid
   4351127
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-GeneID: 4351127
NCBI-ProteinID: XP_015617860
UniProt: Q8L6H7
LinkDB
Position
11:complement(27648695..27655224)
AA seq 647 aa
MPLPAFVAAAARLAVLVAAAATAANAASYARYRRRHLRRIPSPIDESADPLADFRAFPSS
DADDSEEDNFFFGLATAPAHVEDRLEDAWLQFATETSCDDNGNVRDQRPVDALMASAAGD
GGSQQSWRSTGGENIGDREQRKPLRVAMEAMLRGFEILAESGESAGGDNCSHNVAAWHNV
PCPQERLRFWSDPDAELKLAKETGISVFRMGVDWARLMPEEPTEELKSSVNFAALERYRW
IIQRVREYGMKVMLTLFHHSLPPWAGKYGGWKMEKTVTYFMDFVRLVVDRVSNLVDYWVI
FNEPHVFVMLTYCAGAWPGGDPNAIEVATSTLPTGVYNQALHWMAIAHSEAYDYIHSKSK
NERKPIVGVAHHVSFTRPYGLFDVAAVALANSLTLFPYVDSICDKLDFIGINYYGQEVIS
GPGLKLVDNDEYSESGRGVYPDGLFRILIQFNERYKRLNIPFVITENGVSDETDLIRKPY
ILEHLLATYAAIIMGVRVLGYLFWTTSDNWEWADGYGPKFGLVAVDRANNLARKPRPSYF
LFSRVVTTGKITRQDRMSAWRELQQAAVQKKTRPFFRAVDKHGRMYAGGLDRPIQRPFIL
RDWRFGHYKMEGLQDPLSCFIRCIFAPFSRQKKIHYIEDDVISYSIN
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgccactaccggcgttcgtggcggcggcggcgaggctcgccgtcctcgtggccgcggcg
gcgacggcggccaatgccgcctcctacgcgcggtaccggcggcgccacctccgccgcatc
cccagccccatcgacgagtccgccgatcccctcgccgacttccgcgcctttccctcctcc
gacgctgacgactcagaggaggataatttcttctttgggctagcaacagcgcctgcgcat
gttgaggacaggctagaagatgcttggctccagtttgcaactgaaacttcctgcgatgac
aatggaaacgtgcgcgaccagaggccagtagatgcactgatggcatctgctgctggtgat
ggaggctcccagcaatcttggaggtcaacaggtggggaaaatattggtgatagagagcag
aggaaaccacttagggtagccatggaggctatgctcagggggtttgaaattcttgctgag
agtggagaatctgctggcggcgataactgcagccacaatgttgctgcttggcataatgtt
ccatgcccgcaagaaaggcttagattttggtctgatcctgatgctgagttgaaacttgct
aaggagaccggcatcagcgttttccgcatgggggtagattgggcaaggttaatgcctgag
gaaccaaccgaagaattgaagagctcagttaattttgcagcacttgagcggtatagatgg
atcattcaaagggttcgcgaatatggaatgaaagtaatgcttactctgtttcatcactca
cttccaccttgggctggaaaatatggcgggtggaagatggaaaaaactgtcacctatttc
atggattttgtgaggcttgttgttgatcgtgtatccaatttagtggactactgggtgatt
ttcaatgaacctcacgtttttgtgatgctaacttattgtgccggtgcttggcctggtgga
gaccctaatgcaattgaagtagcaacatctactctgccaactggtgtatacaatcaggct
ttgcattggatggctattgcacattctgaagcctatgactacatacattcgaaaagcaag
aacgaaaggaagccaatagttggtgttgcacaccatgtatcgtttacaaggccatatggg
ctatttgatgttgctgctgtcgcgctagctaactcattgaccctttttccttacgtggat
agcatatgtgataaattggacttcattggaatcaactactatggacaggaggttatatca
ggacctggtctaaagcttgtggataatgatgagtatagtgaatctggtcgtggggtttat
cctgatgggctgttccgcatcctgattcaattcaatgaacgatataagagattaaatata
ccttttgtcattactgaaaatggagtttctgatgagactgatctgatacggaaaccatat
atactggaacacttgttagccacatacgctgccatcattatgggtgtccgtgtacttggt
tatttgttttggacaacatcagataattgggaatgggcggatggctatggtcccaagttt
gggcttgttgctgttgaccgtgctaataacctagcacggaaacctcggccttcatacttt
ttattctccagggttgttacaactggaaaaattacaagacaggacagaatgtctgcttgg
agggagctgcaacaagctgcagttcaaaagaaaacacgtccatttttcagggcagtggat
aagcatggtcggatgtatgcaggtggtctagatcggcctattcagaggcccttcatattg
cgggattggagatttggtcactataaaatggaaggcttgcaggatcctttgagttgcttt
ataagatgcatttttgcaccattttcacgccaaaagaagattcactacatagaagatgat
gttatttcttattctattaactga

DBGET integrated database retrieval system