KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351558
Entry
4351558           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit B-like
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: REPA_OB_2 Rep_fac-A_C DUF223
Other DBs
NCBI-GeneID: 4351558
NCBI-ProteinID: XP_015619592
LinkDB
Position
12:2954867..2962322
AA seq 572 aa
MAEVLIPDLEQGDGNPTIIVRVSRLWEYRDQNDETIVHNISLVLLDKKGASIAAYIYPPL
DVVFGPIITEGKVYRLTFYRVRPCSRNYRPVNNRMSINFTKWTTLEEHLDVPADFPCYAY
SPTPYNELRSHVDRKDSFTDVIGVITEVSSVTTIQTRIKDGDSLKRSVCIRNADNVIINI
ALWGERATSFPEDAIISAGEKEPQVAIFVGTLVRGYVRNASLGNVSLSGNSACKWYINID
TPEVNSFKDSIKGNYEPIQFIDIPVPNVIVGAEQKTVAQLKELHPFKFKKHEFQVTVVIK
KFCMQASWWYTACDICKKTAKPYGRAYRCGDPTCPPIVSASPRFKLNIIAGDETAETTFI
LFGRLAQRLIGRSVDTLLHENPSDKDYIPSAITDLLEKQFVWNVSITENTVATGVLSFQV
NRIVGGVVNNTLALLQSPSGSQAYALGPTMALSPAASHDQSIAQSSAPATPSVDISDTNV
GATSLRITGSQDQNIDLECASKTPAQTAEEDEYDQDGDDLPLSQMCTGVATKTSTSKAYK
KRPRPSPVTGAAKKLFKDTDDEGAGGSRSTRA
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggccgaggtcctcattccagatcttgaacagggtgatggcaacccaacgataatcgtc
cgtgtctcaaggttgtgggaatatcgtgatcaaaatgacgaaacaattgtgcacaacatt
agcttggtcctgcttgataaaaagggagctagcattgcagcttatatttatcctccacta
gatgtggtgtttgggcctattatcactgagggcaaggtgtaccgccttaccttctatcga
gtgagaccatgcagcaggaactacaggccagttaacaacaggatgtcgattaatttcaca
aagtggaccaccttggaagaacatcttgatgtgccagctgatttcccttgctacgcttac
tcacctactccatacaatgaactgcgctcgcatgtcgaccgcaaagactcatttacagat
gttattggagtcattactgaggtgtcatcagtgacaactattcagacaaggatcaaggat
ggtgacagcctaaagaggagtgtttgcatccgcaacgccgacaatgtcattataaatatt
gcattgtggggagagcgggcaacaagctttcctgaagacgcgattatcagtgctggtgaa
aaggaaccgcaggtggcaatctttgttggcacacttgtgcggggctatgtcagaaatgcc
tctctaggaaatgtctctttgtcaggtaactctgcttgcaaatggtatatcaacatcgac
acaccagaggtgaactccttcaaagatagcatcaaagggaactacgagcccatacagttt
atcgatataccggttccaaatgttattgttggtgctgaacagaaaacagttgctcaactt
aaggagctccacccatttaaattcaagaaacatgagttccaggttactgttgttatcaag
aagttctgcatgcaggcctcctggtggtatacagcctgtgatatctgcaaaaaaactgca
aagccctatggaagagcatacaggtgtggagacccaacatgcccacctattgtttcagcc
tcaccaagattcaagctgaatataatagcaggagatgagacagcagagaccacatttatt
ctctttggccgtctagctcagaggctcattggtcgctccgttgatacactgctccatgag
aatccatcagataaagactatataccaagtgcaattactgacctgcttgaaaagcaattt
gtctggaatgtcagtatcacagagaacacagttgcaacaggcgttttgtcattccaagtg
aataggattgttgggggtgttgttaacaataccttggcccttctgcagtctccctctggg
tcgcaggcatatgctctggggcctacaatggctctatcaccagctgcatcacatgatcaa
tctattgcccagtcctcagcacctgcaaccccatcggttgatatcagtgatactaatgtt
ggggcaactagcctgagaatcactggatctcaagaccagaatatagatctggagtgtgca
tcaaagactcctgcacagacagctgaagaagatgagtatgatcaggatggtgatgatctt
cctctgtcacagatgtgcactggtgttgctactaaaactagcacctctaaagcatataag
aaaagaccaaggccatctcctgtcacaggggctgcgaagaagctcttcaaggacacagat
gatgagggtgctggtggcagtcgttccaccagggcataa

DBGET integrated database retrieval system