KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351707
Entry
4351707           CDS       T01015                                 
Name
(RefSeq) probable thiamine biosynthetic bifunctional enzyme, chloroplastic
  KO
K14153  hydroxymethylpyrimidine kinase / phosphomethylpyrimidine kinase / thiamine-phosphate diphosphorylase [EC:2.7.1.49 2.7.4.7 2.5.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00897  Thiamine biosynthesis, plants, AIR (+ NAD+) => TMP/thiamine/TPP
osa_M00899  Thiamine salvage pathway, HMP/HET => TMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4351707
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     4351707
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     4351707
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     4351707
SSDB
Motif
Pfam: Phos_pyr_kin TMP-TENI PfkB Carb_kinase HK
Other DBs
NCBI-GeneID: 4351707
NCBI-ProteinID: XP_015618273
UniProt: Q2QWK9
LinkDB
Position
12:4706835..4711283
AA seq 548 aa
MAAAPQQSVHPSLPSSTSTLRLLISSSPRRPPPPPPRARRYNRLAASASAAREMPWPHVL
TVAGSDSGGGAGIQADIKACAALGAYCSSVVTAVTAQNTAGVQGIHVVPEEFIREQLNSV
LSDMSVDVVKTGMLPSIGVVRVLCESLKKFPVKALVVDPVMVSTSGDTLSESSTLSVYRD
ELFAMADIVTPNVKEASRLLGGVSLRTVSDMRNAAESIYKFGPKHVLVKGGDMLESSDAT
DVFFDGKEFIELHAHRIKTHNTHGTGCTLASCIASELAKGATMLHAVQVAKNFVESALHH
SKDLVVGNGPQGPFDHLFKLKCPPYNVGSQPSFKPDQLFLYAVTDSGMNKKWGRSIKEAV
QAAIEGGATIVQLREKDSETREFLEAAKACMEICKSSGVPLLINDRVDIALACNADGVHV
GQLDMSAHEVRELLGPGKIIGVSCKTPAQAQQAWNDGADYIGCGGVFPTSTKANNPTLGF
DGLKTVCLASKLPVVAIGGINASNAGSVMELGLPNLKGVAVVSALFDRPSVVAETRNMKS
ILTNTSRT
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggcggccgcaccacagcaatccgtgcacccaagcttgccctcctcaacctcaaccctc
cgcctcctcatctcctcctccccacgacggcctcctccgccgccgccaagagcccgccgg
tataacaggctcgcggcgtcggcttcggcggcgcgggagatgccgtggccgcacgtgctg
acggtggccggctccgactccggcggcggcgccggcatccaggccgacatcaaggcctgc
gccgcgctgggagcctactgctcctccgtcgtcaccgccgtcactgcccagaacaccgcc
ggcgtccaggggattcatgtggtgccagaggagttcatccgggagcagctcaactcggtt
ctttcggacatgtcggtggatgtggtcaagacaggaatgctcccttcaatcggagtagtc
agagttttatgtgaaagtctaaagaagtttccagtcaaagctttagtggtggatccagtt
atggtgtccacaagtggagatactctttcagaatcatctactctctctgtatatagggat
gaattatttgctatggctgatatagtcaccccaaatgtgaaagaagcgtcgagattactt
gggggtgtatctttgcgcactgtttctgacatgcgcaatgcagcggagtccatttacaaa
tttggtccaaaacatgtacttgtgaaaggtggggatatgctagaatcctcagatgcaact
gatgtattttttgatggtaaggagttcattgagctccatgcgcatcgcataaagacccat
aacacacatggaactggttgcactttagcttcatgtatagcttccgaattagcgaaaggt
gcaacgatgctgcatgctgttcaggtggctaagaattttgtagaatctgctcttcatcac
agtaaagatcttgtcgttggaaatggacctcaaggcccttttgatcaccttttcaagctc
aagtgtccgccatacaatgttggctcacagccaagctttaagccagaccaactcttcctg
tatgcagtgacagactctgggatgaacaaaaagtggggtcgttcaatcaaagaagctgtg
caagctgccattgaaggtggcgctaccattgtacaactgagagaaaaagattccgaaaca
agagagtttttggaagcagccaaagcatgcatggagatttgcaagtccagtggagtacca
ctgctgatcaacgaccgggtagacattgccctggcatgcaatgcagatggtgtccatgtt
ggtcaattggacatgtcggcacacgaagtgcgggagctcctagggccgggtaaaatcatc
ggcgtctcgtgcaagacccctgctcaagcccagcaggcctggaatgatggagcagactac
attggctgtggcggtgttttccctacctccacgaaggcgaacaatcctacattggggttt
gatggcttgaagacagtttgcctggcatctaagctgcctgtggtcgctattggcggcatc
aacgcttcaaatgcaggttcagtgatggagcttggtctcccaaacctcaaaggcgtcgca
gtagtctccgctctgtttgaccgtccgagtgtcgtagccgaaacaagaaacatgaaatcc
atcttgaccaacacctctagaacctag

DBGET integrated database retrieval system