KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351781
Entry
4351781           CDS       T01015                                 
Name
(RefSeq) adenine DNA glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4351781
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4351781
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     4351781
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4351781
 Prokaryotic type
     4351781
SSDB
Motif
Pfam: HhH-GPD NUDIX_4 HHH Whib
Other DBs
NCBI-GeneID: 4351781
NCBI-ProteinID: XP_015619427
UniProt: Q2QW21 Q0IPE3
LinkDB
Position
12:5849694..5852667
AA seq 474 aa
MAKNPKAAKNRRPTTRRPRAAAATATATASASADIEDLASPSGCRAVAGPTTAAAAVRAE
LLRWYDANRRDLPWRRAAEPPAGSGSGRGEEQRAYAVWVSEVMLQQTRVPVVVDYYSRWM
ARWPTVDSLAAATQEEVNEMWAGLGYYRRARFLLEGAKQIVEKGEFPCTASTLREVRGIG
DYTAGAIASIAFNEVVPVVDGNVVRVISRFYAIPDNPKESSTVKRFWQLTGELVDPSRPG
DFNQAMMELGATLCSKTKPGCSQCPVSSHCQALALSSQNASVKVTDFPRVVPKAKPRSDF
AAVCVVQISQGFGEGIAEAEGKDNLFLLIKRPEEGLLAGLWEFPSVLVNEGKTDTLNRRK
EMDKYLKQLLSIDVTRRSSVILREDVGQHVHIFSHIRLTMFVELMILNLKDDGEELCKEG
QDSTKLRLINENAVQSMGLTSGIRKVYNMVKVFKEKRLKEQSQVPTRKRSRRLK
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggccaagaaccccaaggcggccaagaaccgccgccccacgacgcggcgacctcgcgcc
gccgccgccaccgccaccgccaccgcctccgcctccgcggacatcgaggacctggcgtcg
ccgtccgggtgcagggcggtagcggggcccaccacggccgccgcggcggtgcgcgcggag
ctgctgcggtggtacgacgcaaaccggcgcgacctgccatggcggcgcgccgcggagccg
ccggcggggagcgggagcgggcgcggcgaggagcagagggcgtacgcggtgtgggtgtcg
gaggtgatgctgcagcagacgcgggtacccgtggtggtcgactactactcccggtggatg
gcccgctggcccaccgtggacagcctcgccgccgccacgcaggaggaggtgaacgagatg
tgggcggggctcgggtattaccggagggctcgatttctgctcgagggagcaaaacaaatt
gttgaaaaaggcgagttcccttgcacagcatcaacactccgtgaagttcgtggcattggg
gattacacagcaggagccattgcttccatagccttcaatgaggttgtccctgttgtggac
ggaaatgttgttcgagttattagcaggttttatgctattcctgataacccaaaggagtcc
tcaacggtgaagagattctggcagctcactggtgaactggttgacccttcaaggccagga
gacttcaaccaagcaatgatggaactaggagcaacactctgcagcaagacgaagcctggt
tgctctcagtgccctgtctctagccactgccaagcgctcgcactttccagccaaaatgct
tcagtcaaagttacagacttcccacgagtagtcccaaaagccaaaccacggtctgatttt
gctgctgtctgtgttgttcaaatttcacaaggctttggtgaaggtatagcagaggcagag
ggcaaagataatctttttctactgatcaagaggccagaagagggccttctcgctgggctc
tgggagttcccatctgttcttgtgaacgaagggaagactgatacgctgaataggagaaaa
gagatggacaaatatttgaagcagcttcttagcatagatgttacaaggagatccagtgtg
atcctcagggaagatgttggccaacatgttcacattttctcacacattcggctgacgatg
tttgttgagctgatgattttgaacctcaaagatgatggggaggaattatgcaaggaggga
caagatagcaccaaactgagattgattaacgaaaatgcagtccagtcgatgggattgaca
tcaggaatccggaaggtgtacaacatggtcaaggtcttcaaggagaaaaggctgaaagag
cagagccaagtgccgacgaggaaaaggagtagacggctgaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269803
Entry
9269803           CDS       T01015                                 
Name
(RefSeq) adenine DNA glycosylase isoform X1
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    9269803
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    9269803
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     9269803
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     9269803
 Prokaryotic type
     9269803
SSDB
Motif
Pfam: HhH-GPD NUDIX_4 HHH Whib
Other DBs
NCBI-GeneID: 9269803
NCBI-ProteinID: XP_015618796
LinkDB
Position
12:5892437..5902754
AA seq 459 aa
MAKNPKAAKNRRPTTRRPRAAAAAATASASADIEDLAPPSGCRAAVGLTTAAAAVRAELL
RWYDANRRDLPWRRAAEPAGSGSGSGRGEEKRAYAVWVSEVMLQQTRVPVVVDYYSRWMA
RWPTVDSLAAATQEEVNEMWAGLGYYRRARFLLEGAKQIVEKGEFPRTASALREVRGIGD
YTAGAIASIAFNEVVPVVDGNVRVISRLYAIPDNPKESSTVKRFWQLTGELVDPSRPGDF
NQAIMELGATLCRKTKPGCSQCPVSNHCQALTLSNQSASVKVTDYPRVVPKAKPRSDFAA
VCVVQINDNLFLLIKRPEEGLLAGLWEFPSVLVSEEKTDVLNRRKEMDKYLKQVLSIDVK
RRSSVILREDVGQHVHIFSHIRLTMFVELMILNLKDDGDKLCMEGQDNSKLRFIDENAVD
SIGLISGIRKVYNMVKAFKEKRPKEQSQVPSRKRSRRLK
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggccaagaaccccaaggcggccaagaaccgccgccccacgacgcggagacctcgcgcc
gccgccgccgccgccaccgcctccgcctccgcggacatcgaggacctggcgccgccgtcc
gggtgcagggcagcagtggggctcaccacggccgccgcggcggtgcgcgcggagctgctg
cggtggtacgacgccaaccggcgcgacctgccatggcggcgcgccgcggagccggcgggg
agcgggagcgggagcgggcgcggcgaggagaagagggcgtacgcggtgtgggtgtcggag
gtgatgctgcagcagacgcgggtgcccgtggtggtcgactactactcccggtggatggcc
cgctggcccaccgtggacagcctcgccgctgccacgcaggaggaggtgaacgagatgtgg
gcggggctcgggtattaccggagggctcgatttcttctcgagggagcaaagcaaattgtt
gaaaaaggcgagttccctcgcacagcatcagcactccgtgaagttcgtggcattggggat
tacacagcaggagccattgcttccatagccttcaatgaggttgtccctgttgtggatgga
aatgtccgagttatcagcaggctttacgctattcctgataacccaaaagaatcctcaact
gtgaagagattctggcagctcactggtgaactggtcgacccttctaggccaggagacttc
aaccaagcaattatggaactaggagcaacactctgcagaaagacgaagcccggttgctcc
cagtgccctgtctccaaccactgccaagcactcacactttccaaccaaagtgcttccgta
aaagttacagactacccacgagtggttccaaaagccaagccacggtctgattttgctgct
gtttgtgttgttcaaatcaatgataatctctttctattgatcaagaggccagaagagggc
ctgctcgctgggctctgggagttcccatctgttcttgtgagcgaagagaagactgatgtg
ctgaataggagaaaagagatggacaaatatttgaagcaggtccttagcatagatgttaaa
aggagatccagtgtgatcctcagggaagatgttggccaacatgttcacattttctctcac
attcgcctgacgatgtttgttgagctgatgattttgaacctcaaagatgatggggataaa
ttatgcatggagggacaagataacagcaaactgagattcattgacgaaaatgcagtcgac
tcaataggattgatatcagggatccggaaggtgtacaacatggtcaaggccttcaaggag
aagaggccgaaagagcagagccaagtaccatcgaggaaaaggagtagacggctgaagtag

DBGET integrated database retrieval system