KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351872
Entry
4351872           CDS       T01015                                 
Name
(RefSeq) DNA polymerase alpha subunit B
  KO
K02321  DNA polymerase alpha subunit B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4351872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4351872
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    4351872
SSDB
Motif
Pfam: DNA_pol_E_B Pol_alpha_B_N CDC48_N
Other DBs
NCBI-GeneID: 4351872
NCBI-ProteinID: XP_015618976
LinkDB
Position
12:complement(7921620..7926776)
AA seq 625 aa
MEEEIRAEFESSGFSIGGADPGAAAEILSTLLTYCINYKMSPADLVSNWEVYYLNRQLNG
LKLESSYLDGFLSHLQNEVKDRIIKEETSLHIYSSNDVDMLLSSTHTDEEGFLDTPSTKQ
EKPNGESCNSELTPLTTDRPSSSRLAKTNGDRITPFSQRVNKFTQQYVLNSDNVASVPSK
DEIESTEDEVIRRVQPSKRCTLQVQRSQPEPGCRFMYDRIEDRFNYLEDRIRRSGSLFSA
SGLCGEPADATLASEESMFSVGMVICDGEGHLNEKSILLQGSVEHSRGQHVRLDLKDVDR
FSLFPGQVVGIQGHNPSGHCFVVSKLNDSIPNFVDAQLPRAKKQAVDSEGNQSSDVVSRV
LSSVIAAGPYTTSDNLLFEPLQELISYASRKQPQLLILMGPFIDSDHPEIKKGAVDKSFQ
DIFLFEILRKLQDFTQYLGHNVRVILIPSVRDAHHDFVFPQPAFDLNLPEDITHQITCLA
NPSLFSCNEIHFGCCTMDILKHLSGEEISRKPPGEKHGDRIGRICTHILKQQSYYPLYPP
PAGVPLDFSLANGALEIASAPDVLLLPSDLAPFVKVLSLDESSEEPKRFICMNPGRLAKG
IGGGTFVELNYNEDTDKTSASLIRI
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggaggaagagatccgcgcggagttcgagagcagcggcttctccatcggcggcgccgac
ccgggcgccgccgccgagatcctctccacgctgctgacctactgcatcaactacaagatg
agccccgcggatctcgtctccaactgggaggtctactacctcaacaggcaattgaatggg
ttaaagcttgaaagctcatatctggatggttttctgtcacacctgcaaaatgaagtaaaa
gacaggattataaaagaagaaacaagccttcacatttattctagtaatgatgttgacatg
ctcttgagcagtacacacacagatgaagagggattccttgacacaccaagcactaaacag
gaaaagcccaatggagagtcgtgtaactctgagcttaccccactgaccactgataggcca
tcatccagcagattggccaaaacaaatggcgaccgcattaccccgttctctcaacgagta
aataaatttactcaacagtatgttcttaattctgataacgtggctagtgtgccaagtaaa
gacgagattgaatccacagaagatgaagtaattcgaagagttcaacctagtaaaaggtgt
accttgcaagttcaacgctcacagcctgaaccaggttgtaggttcatgtatgacagaata
gaagatagatttaattatttggaagataggataaggaggtctggaagcttgttttctgca
tctgggctttgtggagaacctgcagatgctacccttgcttcagaggagagtatgttttca
gttggcatggtaatttgtgatggggaaggtcatctaaatgaaaaatctatcttgctacaa
ggcagtgttgagcactccaggggacagcatgtacgcttagacttgaaggacgtagaccgg
ttttccttgtttcctgggcaggtcgttggcattcaaggccacaatcctagcgggcattgt
tttgttgtgtcaaagttgaatgattccataccaaactttgttgatgctcaactgcctcgt
gctaagaaacaagctgtggacagtgaaggcaaccaaagttctgacgttgtatcaagagtg
ctatcatcagtcattgcagcaggtccctatacaacgagtgataatctgttgtttgaacct
ttgcaagaattgatatcttatgccagtcgtaagcagcctcaacttcttatattgatggga
ccctttattgattctgatcatcctgaaataaaaaagggagctgttgataagagctttcag
gacatatttcttttcgaaattctgagaaagcttcaagacttcacccagtatttggggcac
aatgttcgtgtgattcttattccatccgtacgtgatgcccaccatgactttgtttttccc
cagcctgcatttgacttgaatttaccagaagacatcacgcatcagattacttgtctggct
aatccaagcctattcagttgtaacgagatacactttggctgctgcacaatggatatcctg
aaacatctgagtggtgaagaaatttctcgcaagccacctggtgaaaagcatggtgacaga
attggtagaatttgcacacacatattgaagcaacaaagctattaccctttatatcctcct
cctgctggtgtacccttggacttttcactcgctaacggagcactggagatcgcatcagct
cctgacgttctcctgcttccttctgaccttgctccatttgtgaaggtgctttccctcgat
gaaagtagcgaagaacctaagcgttttatttgcatgaaccctgggagattagcaaagggc
attggtggaggcacatttgtagaactcaactacaacgaggacacagacaagacaagcgcc
tcccttattcgcatctag

DBGET integrated database retrieval system