KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351925
Entry
4351925           CDS       T01015                                 
Name
(RefSeq) isoflavone reductase homolog
  KO
K21568  pinoresinol/lariciresinol reductase [EC:1.23.1.1 1.23.1.2 1.23.1.3 1.23.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    4351925
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.23  Reducing C-O-C group as acceptor
   1.23.1  With NADH or NADPH as donor
    1.23.1.1  (+)-pinoresinol reductase
     4351925
    1.23.1.2  (+)-lariciresinol reductase
     4351925
    1.23.1.3  (-)-pinoresinol reductase
     4351925
    1.23.1.4  (-)-lariciresinol reductase
     4351925
SSDB
Motif
Pfam: NmrA NAD_binding_10 Epimerase 3Beta_HSD KR GDP_Man_Dehyd YjeF_N Semialdhyde_dh
Other DBs
NCBI-GeneID: 4351925
NCBI-ProteinID: XP_015618256
UniProt: Q2QUH7
LinkDB
Position
12:complement(9278192..9283567)
AA seq 314 aa
MAMEKSRVLIVGGTGYIGRRIVAASLAEGHPTFVLLRPEIGLDIDKLQILLAFKAQGARL
LEASLDDHDGLVAAVRQVDVVVSAMSGVHLRSHNLMLQLKLVEAIKEAGNVKRFLPSEFG
MDPSRMGNALEPGRVTFDEKMEIRRAIEDAKIPHTYVSSNCFAAYFCPNLSQLTSFLPPK
ERVNVYGDGNVKAFFVDEDDVGTYTIKSIDDPRTLNKTIYIRPQDNCLTHNELIAMWEKL
SGKSLTKFHIPAEEFLAPMKDMQFAFQVGITHFYHIFYEGCLTNFDIGDNGAEATILYPE
VQYTRIDEFLKRYL
NT seq 945 nt   +upstreamnt  +downstreamnt
atggccatggagaagagccgggtcctcatcgtcggcggcaccggctacatcggccggcgg
atcgtggcggcgagcttggcggagggccaccccaccttcgtcctgctccggccggagatc
ggcctcgacatcgacaagctccagatactgctggccttcaaggcgcaaggcgcgcggctc
ctcgaggcgtcgctcgacgaccacgatggcctcgtcgccgcggtccggcaggtggacgtc
gtcgtctccgccatgtccggcgtccacctccgcagccacaacctcatgctccagctcaag
cttgtcgaggccatcaaagaagctggaaatgtcaagcgtttcctgccgtcagaatttggc
atggatccatcaaggatggggaatgctcttgaacctgggagggttacatttgatgagaag
atggagataagaagagcaattgaggatgcaaaaatcccccacacatatgtttcttccaac
tgctttgctgcttacttctgtcctaatctcagccagctgacctccttcctccctcccaaa
gagagagttaatgtgtatggggatggtaacgtcaaagcgttttttgtggatgaagatgat
gtgggaacatatacaatcaaatcaatcgatgatcctcgcaccttgaacaagacaatatac
ataagaccacaagataattgcctcactcataacgagctgatcgcaatgtgggaaaaactc
tctggaaaaagtcttacgaaattccacatacctgctgaagaatttttggctccaatgaaa
gatatgcaatttgcttttcaagtgggaataacacatttctaccacattttctacgagggt
tgcttaacaaactttgacattggtgacaatggagccgaagcaactatactgtacccagag
gttcagtacacccgcattgatgaattcctgaaacgctatctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351926
Entry
4351926           CDS       T01015                                 
Name
(RefSeq) isoflavone reductase homolog
  KO
K21568  pinoresinol/lariciresinol reductase [EC:1.23.1.1 1.23.1.2 1.23.1.3 1.23.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    4351926
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.23  Reducing C-O-C group as acceptor
   1.23.1  With NADH or NADPH as donor
    1.23.1.1  (+)-pinoresinol reductase
     4351926
    1.23.1.2  (+)-lariciresinol reductase
     4351926
    1.23.1.3  (-)-pinoresinol reductase
     4351926
    1.23.1.4  (-)-lariciresinol reductase
     4351926
SSDB
Motif
Pfam: NmrA NAD_binding_10 Epimerase aRib 3Beta_HSD Polysacc_synt_2 KR SMP_2
Other DBs
NCBI-GeneID: 4351926
NCBI-ProteinID: XP_015618293
LinkDB
Position
12:complement(9286692..9291574)
AA seq 314 aa
MAMEKSRVLIVGGTGHIGRRIVAASLAAGHPTSVLLRPEIGLDIDKLQILLAFKAQGARL
LEASLDDHDGLVAAIRQVDVVVSAMSGAHIRSHNLMLQIKLVEAIKQAGNIKRFLPSEFG
MDPSRMGNALEPGRVTFDEKMEIRRAIENANIPHTYVSANCFAAYFSPNLCQMKTLLPPK
ERVGVYGDGNVKVFFVDEDDVGTYTIKSIDDPRTLNKTIYIRPQDNCLTQNELIAMWEKL
SGKSLTKFHIHGDEFLASMKDTDFAHQVGVTHFYHIFYEGCLTNFDIGDNGAEATLLYPD
VQYTRINEVIKRYL
NT seq 945 nt   +upstreamnt  +downstreamnt
atggccatggagaagagccgggtcctcatcgtcggtggcaccggccacatcggccggcgg
atcgtggcggcgagcctggcggcgggccaccccacctccgtcctgctccggccggagatc
ggcctcgacatcgacaagctccagatcctgctggccttcaaggcgcagggcgcgcggctc
ctcgaggcgtcgcttgacgaccacgatggcctcgtcgccgcgatccggcaggtggacgtc
gtcgtctccgccatgtccggcgcccacatccgcagtcataacctcatgctccagatcaag
ctcgtcgaggccatcaaacaagctgggaacatcaagcgtttcctgccgtcagaattcggc
atggatccatcgaggatggggaatgctcttgaacctgggagggttacatttgatgagaag
atggagataaggagagcaattgagaatgcaaacatccctcacacatatgtttctgcaaat
tgctttgcagcttacttcagtcctaacctctgtcagatgaaaactctcctccctcccaaa
gagagagttggtgtgtacggggatggtaacgtcaaagtgttttttgtggatgaagatgat
gtgggaacatatacaatcaaatcaatcgatgatcctcgcaccttgaacaagacaatatac
ataagaccacaggataattgcctcactcagaacgagctgatcgcgatgtgggaaaaactc
tctggaaaaagtcttaccaaattccacatacacggtgatgaatttttggcttcaatgaaa
gatacagattttgctcatcaagtgggagtaacacatttctaccacattttctacgaaggt
tgcttaacaaacttcgacattggtgacaatggagccgaagcaactctgctctacccagat
gttcagtacacccgcattaatgaagttataaaacgctatctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351932
Entry
4351932           CDS       T01015                                 
Name
(RefSeq) isoflavone reductase homolog
  KO
K21568  pinoresinol/lariciresinol reductase [EC:1.23.1.1 1.23.1.2 1.23.1.3 1.23.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    4351932
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.23  Reducing C-O-C group as acceptor
   1.23.1  With NADH or NADPH as donor
    1.23.1.1  (+)-pinoresinol reductase
     4351932
    1.23.1.2  (+)-lariciresinol reductase
     4351932
    1.23.1.3  (-)-pinoresinol reductase
     4351932
    1.23.1.4  (-)-lariciresinol reductase
     4351932
SSDB
Motif
Pfam: NmrA NAD_binding_10 Epimerase 3Beta_HSD YjeF_N GDP_Man_Dehyd Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 4351932
NCBI-ProteinID: XP_015618471
UniProt: A3BLJ0 Q2QUF6
LinkDB
Position
12:complement(9397039..9400472)
AA seq 314 aa
MAMEKSRVLVVGGTGFVGRRVVAASLAAGHPTYVLLRPEIGLDIDKLQMLLAFKARGARL
LEASLDDHDGLVAAVRQADVVVSAMSGVHFRSHNLMLQLKLVEAIKDAGNVKRFLPSEFG
MDPSRMGDALEPGRVSFDEKMVIRRAIEDANIPHTYVSANCFAAYFCPNLCQMKTLLPPK
ERVGVYGDGNVKVFFVDENDVGTYAIKSIDDPRTLNKTIYIRPQDNCLTQNELISKWETL
TGKSLEKFHIPGDEFLASMKDLDFASQVGIGHYYHIFYEGCLANFEIGDNGAEATQLYPE
VQYTRMDEYLKRYI
NT seq 945 nt   +upstreamnt  +downstreamnt
atggccatggagaagagccgggtcctcgtcgtcggcggcaccggcttcgtcggtcggcgg
gtcgtggcggcgagcttggcggcgggccacccgacctacgtcctgctccggccggagatc
ggcctcgacatcgacaagctccagatgctgctggccttcaaggcgcggggcgcgcggctc
ctcgaggcgtcgctcgacgaccacgacggcctcgtcgccgccgtccggcaggcggacgtc
gtcgtctccgccatgtccggcgtccacttccgcagccacaacctcatgctccagctcaag
ctcgtcgaggccatcaaagatgctggaaatgtcaagcgattcctgccatctgaattcggc
atggatccatcaaggatgggggacgctctagaacctgggagggtttcatttgatgagaag
atggtgataaggagagcaattgaggatgcaaacatcccccacacatatgtttctgccaat
tgctttgcagcttacttctgtcctaacctctgtcagatgaaaactctcctccctcccaaa
gagagagttggtgtgtatggagatggcaacgtcaaggtgtttttcgtggacgaaaatgat
gtgggaacatatgcaataaaatcaatcgatgatcctcgcaccttgaacaagacaatatac
ataaggcctcaagataactgtctcactcagaacgagttgatctcaaagtgggaaacactc
actgggaaaagtcttgagaaattccacatacctggtgatgaatttttggcttctatgaaa
gatttggattttgctagtcaagtaggaataggacattattaccacatcttttacgagggc
tgcctggcaaacttcgagattggtgacaatggtgccgaggcaactcagctctacccagag
gttcagtacacccgcatggatgagtacctgaaacgctatatctaa

DBGET integrated database retrieval system