KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352692
Entry
4352692           CDS       T01015                                 
Name
(RefSeq) plastidial lipoyltransferase 2 isoform X1
  KO
K03801  lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00785  Lipoic acid metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00881  Lipoic acid biosynthesis, plants and bacteria, octanoyl-ACP => dihydrolipoyl-E2/H
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    4352692
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     4352692
SSDB
Motif
Pfam: BPL_LplA_LipB
Other DBs
NCBI-GeneID: 4352692
NCBI-ProteinID: XP_015619817
UniProt: A0A8J8Y6D3 Q2QMP8
LinkDB
Position
12:complement(25029777..25032347)
AA seq 305 aa
MALPCSYGSHCAALPFPAVVSRAASSPPPRSRGRRPSLPPAGCFHAAPRDAALVSGSAAG
GVSRRRCELFDLHQHIVPFAESWAWQQSIVTRRKGLVGTDEDHSDTLIALQHPPVYTLGT
DSTEDYLHFDVKDAPFEVHRIDRGGEVTYHGPGQLVMYPIINLRYHQMDLHWYFRSLEEV
IIRALQSAFSIKASRVEGLTGVWVGDKKVAAIGIHVSRWIAYHGLALNVTTDLTPFQLIV
PCGIKDRGVGSIKEILQIASDGKEIDETALIDKAYRTLLKEFAEVFQLSLYHNPNWDLQE
SKNFS
NT seq 918 nt   +upstreamnt  +downstreamnt
atggccttgccctgctcctatggctcccactgcgccgccctgcccttccccgccgtggtc
tccagggcggcctcctcgccgccaccgcgctcccgggggagaaggcccagcctaccaccc
gccggatgcttccacgccgcgccaagggacgccgctctggtgtccggctccgctgctggt
ggcgtgagcaggaggaggtgtgagttatttgacctccatcagcacatcgttccatttgcg
gaatcttgggcttggcagcagtccattgtgacaaggaggaaagggttggtaggcacggat
gaagatcactccgacaccttaatcgcgctgcagcatccaccagtttatacgctaggcact
gacagcaccgaggactacctccatttcgatgttaaagatgctccttttgaggttcaccgt
attgaccgtggtggggaggtgacatatcatggtcctggacagcttgtaatgtacccgatt
atcaacttgcgatatcatcaaatggaccttcattggtactttagatcacttgaagaggtg
atcattcgtgcccttcagtccgcattttccatcaaggcatctagggtagaaggtctaacc
ggtgtctgggttggagataagaaagttgcagcaataggaattcatgtctcacgatggata
gcatatcatggtctagcactcaacgtaaccactgacttaacaccatttcaactcattgtt
ccctgcggcataaaagatcgtggcgttgggagcatcaaagagatattgcaaatagcatct
gatggaaaagagatagacgaaacagcattgatcgataaagcctacagaaccctgcttaaa
gagtttgctgaagttttccagctctctttatatcacaaccctaactgggatcttcaggaa
agcaaaaattttagttaa

DBGET integrated database retrieval system