KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352706
Entry
4352706           CDS       T01015                                 
Name
(RefSeq) probable ureidoglycolate hydrolase
  KO
K18151  ureidoglycolate amidohydrolase [EC:3.5.1.116]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4352706
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.116  ureidoglycolate amidohydrolase
     4352706
SSDB
Motif
Pfam: Peptidase_M20 Peptidase_M28 M20_dimer
Other DBs
NCBI-GeneID: 4352706
NCBI-ProteinID: XP_015620061
UniProt: Q2QMN7
LinkDB
Position
12:complement(25087022..25091537)
AA seq 484 aa
MATSAAARFLAALAGAAVLLVLLGGAAGAVVGHDDDAAAARRTMEEFAGFPASDYRGDGG
GGSGGSSPFYVDSDGLQRQIDELASFSDSPVPSVTRVLYSDKDVQARRYIKGIMNQLGLS
IREDAVGNIFGRWEGSEAGLGAVATGSHVDAIPFSGKYDGVVGVLGALEAIRMLKRSGFQ
PKRSLEVIMFTSEEPTRFGISCLGSRLMAGSEELARSLKETVDNQNVSFFDAADSAGYKM
HPEELHNVFLKKDDYFAFVELHIEQGPILEKEGIKIGVVTAIAAPASIKVEFEGNGGHAG
AVLMPARNDAGLAAAELALAVEKHVLESGSIDTVGTVGILQLHPGAINSIPSKSHVEIDV
RDIDEKRRNNVIEKVHQSAIEISKNRGVLLSEFKIINQDPPALSDKSVISAMEFAAKQLN
LEYKLMISRAYHDSLFMARISPMGMIFIPCYKGYSHKPEEYASPEDMANGVKVLALAMAR
LSLQ
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcgacgagcgccgccgcgcgcttcctcgctgccctcgcgggcgccgccgtcctcctc
gtcctgctcggcggagctgctggcgcggtggtggggcacgacgacgacgcggcggcggcg
cggcggacgatggaggagttcgccggattccccgcgtccgactaccgcggcgatggcggt
ggcggcagcggcggctcctccccgttctacgtcgactccgatgggctccagcgccagatt
gatgagctggcttcgttctccgactcgccggtgccgtcggtgacccgcgttctgtacagc
gacaaggacgtgcaagctcgaaggtatataaagggaataatgaatcagcttggcctgtcc
attcgtgaagacgctgttggcaacatttttgggcgctgggagggttctgaggcaggacta
ggagcggttgcaactggttctcatgttgacgcaatcccattctcaggcaaatatgatggg
gtggttggtgtcctgggtgctcttgaggcaattagaatgctgaaaaggtctggtttccag
ccaaaaagatctttggaggttattatgtttacatcggaggagcctacaagatttggaatt
agctgcttgggaagccgcctaatggcagggagtgaagaactggctcgatccctcaaagaa
acagttgacaatcagaatgtgtcattttttgatgctgcagactctgctggctacaagatg
catcctgaggagctacataatgtgtttttgaagaaagacgactattttgcttttgtagaa
ttgcacattgaacagggccccattttggaaaaagaaggtatcaaaattggcgttgtcact
gctattgctgctcctgcaagtattaaggtggagtttgaagggaatgggggccatgctgga
gcagtgctcatgcctgcaagaaatgatgctggactggcggcagctgagttggcattagca
gttgagaaacacgttttggaatcaggatcaattgatactgttgggacagttggtattctg
cagctacatccaggagcaatcaatagcatcccaagtaaatcgcatgtggaaattgatgtg
agagacattgatgagaagaggaggaataatgtcattgagaaggttcaccaatccgcaatt
gagatatcaaagaaccgtggcgtgctattatcagagttcaagatcataaatcaggatcca
cctgctctatctgacaaatcagtcatcagcgcaatggaatttgctgcaaaacagttgaac
ctcgaatataagctgatgattagcagagcttatcatgattcactcttcatggccagaata
tcaccaatgggtatgatcttcattccatgttacaaaggttacagccacaagcccgaagaa
tatgcgtcaccagaggacatggcgaacggtgtgaaggtgcttgccttggcaatggccaga
ttatccctgcagtga

DBGET integrated database retrieval system