KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352832
Entry
4352832           CDS       T01015                                 
Name
(RefSeq) 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase 1
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4352832
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4352832
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     4352832
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1 TM1586_NiRdase
Other DBs
NCBI-GeneID: 4352832
NCBI-ProteinID: XP_015619819
UniProt: Q2QLY5
LinkDB
Position
12:26644928..26651154
AA seq 766 aa
MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN
TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI
VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL
LSSILPVYKEVIAELKAAGATWIQFDEPTLVLDLDSHQLAAFSAAYTELESALSGLNVLI
ETYFADIPAESYKTLTSLNSVTAYGFDLIRGAKTLDLIKSAGFPSGKYLFAGVVDGRNIW
ADDLAASLTTLESLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV
EVNALAKALAGQKDEAYFAANAAAQASRRSSPRVTNEEVQKAAAALKGSDHRRATNVSAR
LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYISAIKEEISKVVKIQE
ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT
VFWSKLAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI
QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS
IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKML
AVLDTNILWVNPDCGLKTRKYNEVKPALTNMVSAAKLIRTQLASAK
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggcgtctcacattgttgggtacccccgcatgggccccaagagggagctcaagtttgcc
ctggagtctttctgggatgggaagagcagcgctgaggatttggagaaggttgcgaccgac
ctcagggccagcatctggaagcaaatggctgacgctgggatcaagtacatccccagcaac
accttctcgtactatgatcaggttcttgacacggctgccatgcttggtgctgtcccagag
cgctactcatggactggtggagagattgggttcagcacctacttctcgatggctaggggc
aatgccactgtccctgccatggagatgaccaagtggtttgacaccaactaccactttatc
gtccctgaacttggtcccaacaccaagttctcctactcttcccacaaggctgtgaatgaa
tacaaggaggctaaggcgctcggcgttgacaccgtgccagtacttgttggaccagtttca
tacttgttgctctccaaacctgccaagggtgtagagaagtcgttcgctcttctttccctt
ctgagcagcatccttcctgtctacaaggaggttattgctgagttgaaggcagctggtgct
acttggattcagtttgatgaacccacacttgttcttgaccttgactctcaccaattggct
gcattctctgctgcatacacagaacttgagtcggcactttctggattgaatgtgcttatt
gagacatacttcgctgacattcctgctgaatcatacaagaccctcacatccctgaacagc
gtgactgcttatggttttgaccttatccgtggagccaagactcttgaccttatcaagagt
gctggtttcccctctggaaagtacctctttgccggtgttgtggatggacgcaacatctgg
gctgatgatctcgctgcatctctcactacccttgagtctcttgaggctattgttggaaag
gacaagcttgtggtctcgacttcctgctcactcatgcacaccgctgtggatcttgtaaat
gagaccaagctcgatagcgagattaagtcatggctcgcttttgctgcccaaaaggtggtt
gaggtgaatgcccttgctaaggcattggctggacagaaggatgaggcttactttgcagca
aacgctgctgctcaggcctccaggaggtcatcacctcgtgtgacaaacgaggaagtccaa
aaggctgctgctgctctgaaggggtctgaccaccgccgtgctaccaatgttagcgctaga
ctggacgcacagcagaagaagctcaaccttccagtccttcctacaaccacaattggttca
ttcccacagactgtggagctcaggagagtccgccgtgagtacaaggcaaaaaagatctct
gaggaggagtacatcagtgccatcaaggaggaaatcagcaaggttgttaagatccaggaa
gagcttgacatcgatgtccttgttcacggcgagcctgagagaaacgatatggttgagtac
ttcggtgagcagctttctggttttgcattcactgccaacggatgggtgcaatcttatgga
tcacggtgtgtcaagccaccaattatctatggtgatgtgagccgccccaaccccatgact
gtgttctggtccaagttggcgcagagcatgacctctcgccccatgaagggaatgttgact
ggtcccgtcacaatccttaactggtcttttgtcaggaatgaccagccgaggtttgagaca
tgctaccagattgctcttgccatcaagaaggaggtcgaggaccttgaggctggtggtatt
caggtcatccaaatcgatgaggctgctttgagagaaggtctgccactccgcaaggcggag
catgctttctacttggactgggctgttcactccttcagaatcaccaactgcggtgttcag
gacaccacccagatccacacccacatgtgctactctaacttcaacgacatcatccactcc
atcatcaacatggacgctgatgtgatcaccatcgagaactcccggtccgacgagaagctg
ctctccgtcttccgcgagggtgtgaagtatggtgctggcattggccctggtgtctatgac
atccactccccaaggatcccgtccacagaggagattgcggaccgcgtcaacaagatgctc
gcggtgctcgacactaacattctctgggtgaaccctgactgcggtctcaagacccgcaag
tacaacgaggtcaagcccgcccttaccaacatggtttcggccgccaagctcatccgcacc
cagctcgccagcgcgaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352833
Entry
4352833           CDS       T01015                                 
Name
(RefSeq) 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase 2
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4352833
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4352833
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     4352833
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1 TM1586_NiRdase
Other DBs
NCBI-GeneID: 4352833
NCBI-ProteinID: XP_015619851
UniProt: Q2QLY4
LinkDB
Position
12:26657183..26662934
AA seq 766 aa
MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN
TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI
VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL
LSSILPVYKEVIAELKAAGATWIQFDEPTLVLDLDSHQLAAFSAAYTELESALSGLNVLI
ETYFADIPAESYKTLTSLNSVTAYGFDLIRGSKTLDLVKSAGFPSGKYLFAGVVDGRNIW
ADDLAASLTTLESLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV
EVNALAKALAGQKDEAYFAANTAAQASRRSSPRVTNEEVQKAAAALRGSDHRRATNVSAR
LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEDEYVSAIKEEISKVVKIQE
ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNAMT
VFWSKMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI
QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS
IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVLAAKLIRTQLASAK
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggcgtctcacattgttggatacccccgcatgggccccaagagggagctcaagtttgcc
ctggagtctttctgggatgggaagagcagcgctgaggatttggagaaggttgcgaccgac
ctcagggccagcatctggaagcaaatggctgacgctgggatcaagtatatccccagcaac
accttctcgtactatgatcaggttcttgacacgaccgccatgcttggtgctgtcccagag
cgctactcatggaccggtggagagattgggttcagcacctacttctcgatggctagggga
aatgccactgtccctgctatggagatgaccaagtggtttgacaccaactaccactttatc
gtccctgaacttggtcccaacaccaagttctcctactcttcccacaaggctgtgaatgaa
tacaaggaggccaaggcgctcggcgttgacaccgtgccagtacttgttggaccagtttca
tacttgttgctctccaagcctgccaagggtgtagagaagtcgttcgctcttctttccctt
ctcagcagcatccttcctgtctacaaggaggttattgctgagttgaaggcagctggtgct
acatggattcagtttgatgagcccacacttgttcttgaccttgactctcaccaattggct
gcattctctgcagcgtacacagaactcgagtcggcactttctggattgaatgtgcttatt
gagacatacttcgctgacattcctgctgaatcatacaagaccctcacatccctgaacagc
gtgactgcttatggttttgaccttatccgtggttccaagactcttgaccttgtcaagagt
gctggtttcccctctggcaagtacctctttgctggtgttgtggatggacgcaacatctgg
gctgatgatctcgccgcatctctcaccaccctcgagtctcttgaggctattgttggaaag
gacaagcttgtggtctcgacttcctgctcactcatgcacaccgctgtggatcttgtaaat
gagaccaagctcgatagcgagattaagtcatggcttgcttttgctgcccaaaaagtggtt
gaggtgaatgcccttgctaaggcattggctggacagaaggatgaggcttactttgcagca
aacactgctgctcaggcctccaggaggtcatcacctcgtgtgacaaacgaggaagtccaa
aaggctgctgctgctctgagggggtctgaccaccgccgtgctaccaatgttagcgctagg
ttggacgcacagcagaagaagctcaaccttccagtccttcctacaaccacaattggttca
ttcccacagactgtggagctcaggagagtccgccgtgagtacaaggctaaaaagatctct
gaggatgagtacgtcagtgccatcaaggaggaaatcagcaaggttgttaagatccaggaa
gagcttgacattgatgtgcttgttcacggcgagcctgagagaaacgatatggttgagtac
tttggtgagcagctttctggttttgcatttactgccaatggatgggtgcaatcctatgga
tcccggtgtgtcaagccaccaattatctatggtgatgtgagccgccccaacgccatgact
gtgttctggtccaagatggcgcagagcatgacctctcgccccatgaagggaatgttgact
ggtcccgtcacaatccttaactggtcttttgtcaggaatgaccagccgaggtttgagaca
tgctaccagattgctcttgccatcaagaaggaggtcgaggaccttgaggctggtggtata
caggtcatccaaatcgatgaggctgctttgagagaaggtctgcccctccgcaaggcggag
catgctttctacttggactgggctgttcactccttcagaatcacaaactgcggtgttcag
gacaccacccagattcacacccacatgtgctactctaacttcaacgacatcatccactcc
atcataaacatggacgccgatgtgatcaccatcgagaactcccggtccgacgagaagctg
ctctctgtcttccgcgagggtgtgaagtatggtgctggcattggtcctggtgtctacgac
atccactcccccaggatcccgtccacggaggagattgcggaccgcatcaacaagatgctt
gcggtgctcgacactaacattctctgggtgaaccctgactgcggtctcaagacccgcaag
tacaccgaggtgaagcctgccctcaccaacatggttttggccgccaagctcatccgcacc
cagctcgctagcgcgaagtga

DBGET integrated database retrieval system