KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266301
Entry
9266301           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC9266301
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: REPA_OB_2
Other DBs
NCBI-GeneID: 9266301
NCBI-ProteinID: XP_015614028
LinkDB
Position
10:complement(6408919..6412028)
AA seq 202 aa
MVAIIYDDQVDRLDPLLREGSAYYVSRMSIEPASMILYQWLADHAFVCVFTRDTTITEIA
NMHEKILPLLPPLMPLDQVFEFTYHNDIYVDVIGMVIFVSSIGFVEGYKKRIPYRNILII
DGSFKPVMLVIKDKMLTDHLTKWARCSNEQPIIVATMRRAKREEDHSLHTTCFSRVQFDP
NVAVARELRKSLSMELTGKSSP
NT seq 609 nt   +upstreamnt  +downstreamnt
atggtagctatcatttatgatgaccaagtggatcgtttagatcccctacttcgagagggt
tccgcatattatgtgtcgaggatgtccatagagccagctagtatgattttgtatcagtgg
cttgcagaccatgcttttgtgtgtgttttcacacgtgatactactattactgagatagca
aacatgcatgagaagatattaccattactccctccgcttatgccacttgatcaagttttc
gagtttacttaccataatgacatttatgttgatgttattggaatggtcatctttgtaagc
tctataggctttgtggaaggctacaagaagaggatcccatataggaatattcttataatt
gatggcagtttcaaacctgtgatgttagttattaaggataaaatgcttaccgaccattta
actaaatgggcgagatgctctaatgagcaacctatcattgtagcaacaatgcgtagagca
aagcgtgaagaagaccatagcctgcacactacatgcttcagtagggtgcagtttgatcct
aatgttgcagttgcacgtgaattaaggaagagcctcagtatggagcttactgggaagtct
tctccatga

DBGET integrated database retrieval system