KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266365
Entry
9266365           CDS       T01015                                 
Name
(RefSeq) probable gluconokinase
  KO
K00851  gluconokinase [EC:2.7.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    9266365
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     9266365
SSDB
Motif
Pfam: SKI AAA_33 AAA_18 AAA_16 AAA_17 dNK AAA ABC_tran Cytidylate_kin AAA_28 AAA_22 Rad17 APS_kinase CoaE tRNA_lig_kinase Cytidylate_kin2 Zeta_toxin RNA_helicase AAA_14 PRK AAA_5 AAA_24 CPT Viral_helicase1 RsgA_GTPase NACHT
Other DBs
NCBI-GeneID: 9266365
NCBI-ProteinID: XP_015643906
UniProt: A0A0P0WRJ9
LinkDB
Position
6:839337..841386
AA seq 196 aa
MAASDLTHRPGLAIVIMGVSGCGKSTVAALLAETLGCSFIEADDYHSQANKAKMSKGIPL
TDGDRIPWLEALRDAVRERLDHGEDVAVSCSALQQKYREILREGDCSFRSGSGSYSSCRV
KFVCLEASAEVIADRIRRRSMEGEHFMPASLLQSQLDLLQIDEAEGITVVDATVRPNAIV
HDTIARFREQLASTVC
NT seq 591 nt   +upstreamnt  +downstreamnt
atggctgcctccgatctcacgcaccgaccaggtttggcaatcgtgatcatgggagtcagt
ggctgcggtaaatcgacagtagcagcactgcttgctgaaaccttaggctgcagcttcatc
gaagcagacgactaccattctcaggcaaacaaagccaagatgagcaagggcatccctctc
accgacggcgaccgcatcccgtggctggaggccctccgcgacgctgtcagggagcggctg
gatcatggcgaggacgtcgccgtcagctgctcggcattgcagcagaagtacagggagatc
ctcagggaaggagactgcagcttcaggtcaggttcagggagctactccagctgcagggtg
aagtttgtgtgcctggaggcatcagcagaggtgattgctgacaggatcaggaggagatca
atggaaggggagcacttcatgccggcgagcttgctccagagccagctcgacctgctgcag
atcgatgaggcggaggggatcaccgtggtcgatgccacggtgcgccccaacgccatcgtc
cacgacaccattgctcggttcagggagcagctagcatccactgtgtgctga

DBGET integrated database retrieval system