KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266475
Entry
9266475           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 1 isoform X2
  KO
K03125  transcription initiation factor TFIID subunit 1 [EC:2.3.1.48 2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    9266475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    9266475
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    9266475
   03036 Chromosome and associated proteins [BR:osa03036]
    9266475
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     9266475
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9266475
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  TAF1 family
   9266475
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     9266475
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    9266475
SSDB
Motif
Pfam: DUF3591 Bromodomain TBP-binding ubiquitin zf-CCHC_6 Rad60-SLD
Other DBs
NCBI-GeneID: 9266475
NCBI-ProteinID: XP_015643265
UniProt: Q67W65
LinkDB
Position
6:complement(26359663..26374937)
AA seq 1810 aa
MGDGERREDENPTTSAADDDDDEDYDEPGGGNHFLGFMFGNVDDSGDLDADYLDEDAKEH
LFALADKLGPSLKDIDLIKPSAAPTDPSEQDYDAKAEDAVDYEDIDEEYDGPEVEAATEE
DHLLSKKDYFSSNAVYASVNSKVSVFDEENYDEDEEPPNDNDLPSDNIVQNCTSASAEQL
DMAPSNDNLAVEKMSSSLSEPEESFESEAFQKEMVAEEQLESKTATSLPVLCIEDGSVIL
KFSEIFGAQEPVRKAKMDRHKRPVNKELQITNFTDIVEEDEEVFLRSTIQNLSALKHIKT
NDNFVESDSDESTSDVALRLKDSCLSEQPMKDKDIPTAVQSPVFPDFYPLEHENWENDIV
WGNSPTTAIQPCLTSCAISKESLDDHNEDQAEGYVSGCWDVQNKFHSSSVMADPFGHTEI
PDSTSYRSPENSYSPLRKETAQENNSLDEPNNITQPVKIDTTRHLNKLSLLNKELLEGSW
LDNIVWDPSEDVPKPKLIFDLKDDHMLFEILDEKNGDHLRSHARAMIVTRPMKTSAVENV
DHNNQAIALSGRFNISNDKFYSNRKMSQQARSHAKKRATMGLKLVHSVPAQKLQTMKPKL
SIKEIANFHRPKAKWYPHENKLTARFQGDECSHGPMTAIVMTLGGKGVKFLVNAEETPLS
VKSKASKKLEFKPSEKIKLFCSGKELQDDISLAMQNVRPNSILHVVRTEIHLWPKAQRLP
GENKPLRPPGAFRKKSDLSVKDGHVFLMEYCEERPLLLANAGMAARLCTYYQKTSPSDQT
ATSLRSNSDGLGTMLAIDPADKSPFLGNIRSGSHQSCLETNMYRAPVFPHKVATTDYLLV
RSPKGMLSLRRIDKLYAVGQQEPHMEVFSPGTKNMQNYILNRILVYVYREFRAREKPGII
PQIRADELPIQPPITEAIVRKRLKHCADLRKGPKGHLFYIQRPDFRIPSEEELRRLLTPE
NVCCYESMQAGQYRLKHLGIEKLTQPVGLASAMNQLPDEAIELAAAAHIERELQITSWNL
TSNFVACTNQDKENIERLEITGVGDPSGRGLGFSYVRVTPKAPVSNSTHKKKSAAAKGTT
VTGTDADLRRLSMDAARELLLKFGVPEEQIDKLTRWHRIAMVRKLSSEQAASGVTMDEIP
VSKFARGQRMSFLQLQQQTKEKCQEIWDRQIQSLSAMDGNENGSDTEANSDLDSFAGDLE
NLLDAEEFDDEDVGNTDIRSDKMDGMRGLKMRRCHTQSQINEEIQDDVAEAALVEKLLEE
SDSDMKRKKQPVETTNYSTPMYNQGNKMKQGKAGQMIKSSVYAGALTPKESIPREAKEVE
NFAEGSLPSKLRTKTGFDANDDIILVKRKNIPGKDGFKEKRQGARGDTLVCGACGQLGHM
RTNKLCPKYGEDPETSEMDVNSIRSHPPDIVSNAQIKTSNKRLVAKVSSEAFETEGPESI
EKAKPVPVKFKCGAPEKSLDRNMSISASLVSDKRMMDATDSKSTGKVNKIKISNKIKYDD
YPPDTPKPSVVIRPPAEVEKDLPRKKIIIKQPKVLGDQQRPTELRSGQEPRKTRKIVELS
SFEKRDREDDNGFSGQPIQINSSHDRGWGLVGKRSKGIMESSESWRAFEEQRERQEQRLI
EARIYDARREDELQKAKKKNKKKKKHEFRDDDLLDPRPYKNDRRVPERGRAAKRRTPADM
TEYTPPAKRHRGGEVELSNILEKIVDHLRTMSCSFLFRKPVTKKEAPDYFDIIERPMDLG
TIRDKVRKMEYKNREDFRHDVAQIALNAHTYNLNRHPHIPPLADELLELCDYLLEESADV
LDDAEYAIED
NT seq 5433 nt   +upstreamnt  +downstreamnt
atgggcgacggcgagcgccgcgaggacgagaacccgaccaccagtgccgcagatgacgat
gatgatgaggattatgatgaacctggtggagggaatcacttcttgggcttcatgttcggc
aatgttgatgattctggtgacttggatgctgactatctcgacgaggatgcaaaggagcac
ctttttgcactggcggacaagcttggcccatctttgaaagacattgatctgatcaagcct
tctgcagcaccaactgatccttctgagcaagactatgatgcaaaagcagaagatgctgtt
gattatgaagatattgatgaagaatatgatggacctgaagttgaagcagctacagaggag
gaccatttgctatccaaaaaagattacttctcttcaaatgcagtttatgcttcggtcaat
agtaaagtttcagtgtttgatgaggagaactacgatgaggatgaagaaccaccaaatgat
aatgatttgcctagtgataatattgtgcaaaactgcacttcagcttcagctgagcaactg
gatatggcaccgtcaaatgacaaccttgctgttgaaaagatgtctagttcgttatcagaa
ccagaagaaagttttgaaagtgaagcttttcagaaagaaatggttgctgaagagcaactt
gagtctaaaactgcaacttccctcccagttttatgcatagaggatgggagtgttatattg
aagttctctgaaatttttggagcccaggagcctgtaagaaaagccaaaatggaccgccat
aagcgcccagtgaataaagagctccagattacaaatttcacagatattgttgaagaagac
gaggaggtatttctacgcagcactattcaaaatttgtcagctttgaagcatatcaagacg
aacgataattttgttgagagtgacagtgatgagtcaacttcagatgttgccttaagactg
aaagactcgtgcctttccgaacaaccgatgaaagataaagatattcctactgctgtacaa
tctccagttttccctgatttttatccactcgagcatgaaaattgggaaaatgatattgtt
tggggcaattcaccaacaaccgcaattcagccttgcttaacaagctgtgcaatatccaaa
gaaagcttggatgaccacaatgaagaccaggccgagggttatgtctctgggtgttgggat
gtacagaataaatttcatagttcttcagtaatggcagatccttttgggcatacagaaata
cctgattcaactagttaccgttcccctgagaacagctattctccattaagaaaggagact
gctcaggagaataacagcttagatgaaccaaataacataactcaaccggttaaaatcgac
accacacggcatttaaacaagctctctttactgaacaaggagttgttagaaggatcttgg
ttggataacatagtttgggatcccagtgaggatgtaccaaagcccaagctaatctttgac
cttaaagatgatcacatgctttttgaaatattagatgaaaagaatggggatcacctccgc
tctcatgctcgtgccatgattgttactcggccaatgaaaacttcagcagtggaaaatgtt
gaccataacaatcaagcaattgcattgagtgggagattcaacatttccaacgacaaattt
tattctaacaggaaaatgtcgcagcaagctagatctcatgctaaaaagcgtgctacaatg
ggcttaaagttggtacattctgttcctgctcagaagctccagaccatgaagccaaagttg
agcatcaaagaaatcgcaaacttccatagaccaaaagctaagtggtatccacatgaaaat
aaacttactgctagatttcaaggagatgagtgcagtcatgggccaatgactgctattgtg
atgactttgggaggaaaaggagtcaaatttctggtcaatgcagaggaaactccactttct
gtaaaatcaaaagcttccaaaaagcttgaatttaaaccttctgagaagatcaaattgttc
tgttctggaaaagagcttcaggatgacatctccttggctatgcaaaatgtgcgaccaaac
tctattctgcatgttgttcgcactgaaatacatttatggccaaaagcacagagattgcct
ggtgagaataagcctctacgtcctcctggtgcattcaggaaaaaatctgacttgtctgtt
aaggatggacatgtatttttgatggaatactgtgaggagaggcctttgcttcttgcaaat
gcaggaatggctgcacgactgtgcacgtattaccagaagacttcaccttctgaccaaaca
gctacatccctgcgaagcaacagtgatggactgggtacaatgcttgctattgatcccgct
gacaaatctccttttctggggaacattcgttctggctcccaccaatcatgtcttgagaca
aatatgtacagagcacctgtatttcctcataaggttgcgacgacagattatcttttagtt
cgttcacccaaagggatgctttctcttcgtcgcattgacaagttgtatgctgttggccaa
caggaacctcatatggaagtattttcacctgggacaaaaaatatgcagaattatattctg
aatcggattcttgtgtatgtatatcgtgagttccgtgctagggagaagcctggtattatt
cctcagattcgagctgatgaattacctattcagcctcctataacagaggctattgtgagg
aaacggttaaagcattgcgcggatttaaggaaaggaccaaagggacatttgttctatatt
cagagacctgattttcggattccatcggaggaagaactgagaagattattgacacctgaa
aatgtctgctgttatgagagtatgcaagctggccagtatcgtctcaagcacttaggaatt
gagaagcttactcagcctgtgggacttgcatctgccatgaatcagcttcctgatgaagct
attgagcttgctgctgcagctcatattgagagggaattgcaaatcactagctggaatctt
accagcaattttgttgcttgtacaaaccaggacaaggaaaatatagagagattagaaatt
actggtgttggtgatccatctggccgtgggctaggatttagctatgtacgagtaactcca
aaagcacctgtatccaattcaacacataagaagaagtcagctgctgcaaaaggcaccact
gtgactggaacagatgctgatctccgcaggttgagcatggatgcagctcgagagttgcta
ctcaaatttggcgttccagaagagcaaattgacaagttaacaaggtggcatcggatcgcg
atggtgaggaagctttcaagtgaacaagctgcatcgggtgttacaatggatgaaattcca
gttagtaagtttgcacggggacaaaggatgtcttttctgcagcttcagcagcaaactaaa
gagaaatgtcaggaaatttgggacagacaaattcagtcactttcagctatggacggcaat
gaaaatggcagtgacacagaagctaacagtgatcttgactcatttgctggggatcttgaa
aatttgctagacgcagaagaatttgatgatgaagatgttggtaatacagacataagaagc
gataaaatggatggaatgagagggcttaaaatgagaaggtgtcatactcaatcccaaatt
aatgaggaaattcaagatgatgtagcagaggctgctctagtagaaaaactgcttgaagag
agtgatagtgatatgaagaggaagaagcagcctgtggaaactacaaattatagcactcct
atgtataatcagggcaataaaatgaagcagggtaaggctggccaaatgattaaatcgtct
gtatatgccggtgcattaaccccaaaagagagcataccaagagaagccaaggaggttgaa
aattttgctgaaggaagtttaccctcaaaactaagaacaaagacaggatttgatgcaaat
gatgatattattctagtaaaaaggaaaaatatcccaggaaaggatgggttcaaggaaaag
agacagggtgcaaggggagacactcttgtatgtggagcttgtggtcagctcgggcacatg
cggaccaacaaactgtgccccaagtacggggaggaccctgaaacatccgaaatggatgtc
aattccatcaggtctcatcctcctgatattgtgagtaatgctcaaataaaaacatcaaac
aagaggttggtagcaaaagtttcgtctgaagcttttgaaactgaaggacctgaaagtatt
gaaaaggctaaacctgtccctgtaaaattcaaatgtggagcacctgagaagtcattggat
aggaacatgtcaatctcagcttctttggtttctgataaacgtatgatggatgctacagat
tcgaaatcaactggaaaggttaataagattaaaatatctaacaagataaaatatgatgat
tatcctcctgatactcctaagccatctgttgtaataaggcctcctgctgaagtggagaag
gatctacctcgtaagaaaattattatcaagcagcccaaggtgcttggagatcagcaaaga
cctactgaacttaggagtggtcaggagcccagaaagacaaggaaaattgttgaattgtca
agctttgagaagagagacagagaggatgataatggtttttctggacaacctattcagatc
aattcctcacatgatagggggtggggtctggtgggaaaaagaagcaaaggaataatggaa
agtagtgaatcctggagagcttttgaggagcaacgagagagacaagaacagagactaatt
gaagctaggatatatgatgcaaggagagaggatgagctccagaaggcaaagaagaaaaac
aagaaaaagaaaaaacatgaatttcgagatgatgacctacttgatcctaggccatacaaa
aatgacagaagggtacctgaaagaggtcgagcggcaaagagacgtaccccagctgatatg
acagaatacacaccaccagctaagcggcacagaggaggagaggttgagctctccaacata
ttggaaaaaatagttgaccacttgcggacaatgagctgttcattccttttccgtaaaccg
gtgacgaagaaagaggctcctgattactttgacataattgagcgtccaatggatcttggt
actataagggacaaggtgcgaaagatggagtataaaaatagggaggattttaggcatgat
gtggctcagatagcactgaatgcacatacatacaatcttaaccgccatccccacatccct
ccgcttgctgatgagctcttggagttgtgtgattatcttcttgaggaaagcgcggatgtg
ctagatgatgcggaatacgcgatcgaggactag

DBGET integrated database retrieval system