KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266710
Entry
9266710           CDS       T01015                                 
Name
(RefSeq) (R)-mandelonitrile lyase-like
  KO
K08248  (R)-mandelonitrile lyase [EC:4.1.2.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00460  Cyanoamino acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    9266710
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     9266710
SSDB
Motif
Pfam: GMC_oxred_C GMC_oxred_N FAD_binding_2 DAO Pyr_redox_2 NAD_binding_8 Lycopene_cycl HI0933_like Pyr_redox
Other DBs
NCBI-GeneID: 9266710
NCBI-ProteinID: XP_015641863
UniProt: Q67W87
LinkDB
Position
6:26904405..26908205
AA seq 592 aa
MAAIPTRLHLLLAALLVAPTLAAAQPRGFGGVVAPPPAYARYVVDAAETAAEEAYDYIVV
GGGTAGCPLAATLAGPGGGRVLVLERGGAPAEFPPLATAGGFVRTLAMADPAPESDAPAQ
TFASEDGVPNVRARVLGGATSINAGFYSRAHPDWFRSHGEGGEAMNWDMKLVNSSYEWVE
RELAFQPVVRGWQAAVRAGLLEANVTPWNGFTMDHVSGTKVGATTFDSSGRRRSAADLLA
FARPGRLRVAIRATVTRIIMSPIEPVARRGRSPQPAVAASGVVYQDRLLQQHHALLRPGG
EVILSAGSLGSPQLLLLSGIGPANDLTSLGIPVFADVPDVGKHMFDNPRNGISIIPSIPI
DHSLIQVVGIPSANGNESYLEAASYIVPLAPILRRGGPFSPSSPLYVTVVTIMEKVPGPL
SEGSLWLTSSNPLESPSVRFNYLSRREDLARCVTGMRRVAKVLESTTMDVFRSAMGSLSQ
DSRRREFRIVGAALPVDWRTNDTALGDFCQQTVATLWHYHGGCVAGSVVDRDFRVFRVRA
LRVVDGSTFRETPGTNPQATIMMMGRYIGQKMIDERHSRRQVRTSTDSSSNA
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggccgccattcccacccgcctccacctcctcctcgccgctctcctcgtcgcgccaacc
ctcgccgccgcccagccccgcggtttcggaggggtggtggcgccgccgccggcgtacgcg
cggtacgtggtggacgcggcggagacggcggcggaggaggcgtacgactacatcgtggtc
gggggaggcacggcggggtgcccgctcgccgcgacgctggccgggccggggggcgggcgc
gtgctggtgctggagcggggcggcgcgcccgcggagttcccgccgctcgccaccgcgggc
gggttcgtcaggacgctcgccatggcggacccggcgcccgagtcggacgcgcccgcgcag
accttcgcctccgaggacggcgtgcccaacgtccgcgcccgcgtcctcggcggcgccacc
tccatcaacgccggcttctactcgcgcgcccaccctgactggttccgcagccacggcgag
ggtggtgaggcgatgaattgggacatgaagctagtgaattcgtcctacgagtgggtggag
cgtgaactggcgttccagccggtggtgcgtgggtggcaggcggcggtgcgtgcggggttg
ctggaagctaatgtgacgccatggaacgggtttacaatggaccatgtctctggcaccaag
gttggtgccaccacgttcgattcgtcaggccgccgccggagtgccgcagatctcctcgcc
tttgcacgccctggccgtctccgtgttgccatccgtgcgacggttactcgcatcatcatg
agcccaattgaacctgttgcacgccgtggaaggtctccacagccagcagtagcagcaagc
ggtgtcgtttaccaggaccgtcttctccagcagcaccacgcattgttgcgcccagggggg
gaggttatactttctgcaggctccctagggagtccccagttgctgctcctcagtggcatt
ggccctgccaatgatcttacatccctaggcatcccagtttttgctgatgtccctgatgtt
ggcaagcatatgtttgacaacccccgtaacggcatctccatcatcccatcaatcccaatc
gatcactcccttatccaggtagttggcattccttctgctaatgggaatgagtcctacctt
gaggctgcatcatacattgttccccttgctcccatcttacgccgtggtggtccgttcagc
ccgtcttcgccactttatgttactgtggtaaccatcatggaaaaggttcctggaccattg
tctgaaggttcactttggctcacatcatccaatcccttggagagcccttcagtgcggttc
aactacttgagccgtcgtgaggacttggcacggtgtgtgacgggcatgcggcgtgtggcg
aaagtgcttgagagcacgacaatggatgtgtttcgttcagcgatgggatcattgagccaa
gacagcaggaggagggagttcaggattgttggggctgcactgccagttgactggagaaca
aatgacacagctctgggtgatttctgccagcagactgtggcaacattatggcattatcat
ggaggatgtgtagctggaagtgtggttgacagggatttccgtgtttttcgtgtgcgtgct
cttcgtgtggtggatggatcaacattcagggaaacacctgggaccaatcctcaagccaca
atcatgatgatgggcaggtatatagggcagaagatgattgatgagcgtcacagcagaagg
caagtcagaacatcaacagattcctcttccaacgcctga

DBGET integrated database retrieval system