KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266862
Entry
9266862           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit D isoform X1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: REPA_OB_2 DUF223 Rep_fac-A_C
Other DBs
NCBI-GeneID: 9266862
NCBI-ProteinID: XP_015633810
LinkDB
Position
4:complement(2069996..2082389)
AA seq 469 aa
MAFSGCTRISSSSLAAPFRAIFAPISAAPLFCPPDLVLIVAVRSVRYVRCCCAAVPFTIS
SCSGCGPHLLCPYMSAKMAFDLLCDISLASRGWKIRARIARMWDYTGTANDVPPMHVDLV
LVDEKGNAMYAEIPGVEADKFRPLLQESKVYTFSKFLVLPSKPAYKPFPNKYMIKLTPWT
NVEQVNEVPADFPSHVFNLVQFSDLSQRVGMQEYFTDVIGMIIGVSKLAYVRMASKTSDT
PKRVIALRDLANCEVKLVLWGEHALDFDADAVHSVGQDNVVVGIFVGTLMKAYNKTLSGG
SACKWYLNEDIPEINQFFDSLGDSAPKIQWISAGAKSFGSSQRPAQLEHKSVADLKKIDP
WEAAGAGFSSTVTIAKLSPSQSWWFSSCSRCHRAATAYGSSYKCYSGCSSVTAIPKYRLC
LIGTDGTDSAEFVLFGRVAQQVVGRPVMNLIKFQGRSDNIPKEIAAVVS
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggcattttctggatgcactcgcatttcctcttcgtcgttggccgcgccattccgtgcg
atttttgctccgatatcagcggctccattgttttgcccccctgatttggtgcttattgtc
gcggtcaggtccgtgcgatacgttcgttgctgttgtgctgctgttccctttaccatcagc
tcctgttcaggttgcggaccgcatctcctgtgcccgtacatgtcggctaagatggctttc
gatttgctgtgtgacatatccctagcaagcagaggctggaagatccgtgcaaggatagca
agaatgtgggactacactggtacagctaacgatgtgcctcctatgcatgttgatctggtg
cttgttgatgagaagggaaatgcaatgtatgctgaaattccaggcgttgaggctgataag
ttcagaccacttcttcaggaatcgaaagtctacacttttagcaagttccttgttttgcct
agcaaacctgcatacaagcccttccctaacaagtatatgatcaagcttactccatggaca
aacgtggaacaggtcaatgaagttcctgctgatttcccatcccatgtgtttaatttggtt
caattctcagatctaagccagcgcgttgggatgcaagagtacttcactgatgtgatcggt
atgatcattggggtatcaaagctagcctatgtccgaatggcgtctaaaacgtcagacaca
cctaagagggtcattgctctaagggatcttgcgaactgtgaggttaaacttgtcctatgg
ggagagcatgctctcgactttgatgctgatgctgttcatagtgttggccaagataatgtt
gtcgttggtatctttgttggtactcttatgaaagcatataataaaactcttagtggagga
tcagcctgcaaatggtatttaaatgaggacataccagagataaaccagttctttgatagc
ctgggtgatagtgctccaaagatccagtggatatcagccggagcaaagtcctttggttcg
tcacaacgcccagcacagttggagcataaatctgttgctgaccttaaaaagattgatcca
tgggaagctgcgggtgctggcttctcatctactgtgaccatagctaagttgagcccatct
cagtcatggtggttttcatcctgttcccgttgtcatagagccgcaactgcatatggatct
agctataaatgctacagcggttgctcatcagttactgccattccaaagtaccgtctttgc
ctgataggaaccgatggaactgattcagcagagtttgtgctgtttggacgtgttgcgcag
caagttgttggccgtcctgttatgaatcttatcaaatttcagggcagatcagacaatatt
cctaaagaaattgctgctgttgtttcatag

DBGET integrated database retrieval system