KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266900
Entry
9266900           CDS       T01015                                 
Name
(RefSeq) ribonuclease H2 subunit B
  KO
K10744  ribonuclease H2 subunit B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    9266900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    9266900
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    9266900
SSDB
Motif
Pfam: Ydr279_N RNase_H2-Ydr279
Other DBs
NCBI-GeneID: 9266900
NCBI-ProteinID: XP_015634999
UniProt: Q7XKT8
LinkDB
Position
4:23843536..23847899
AA seq 279 aa
MASWCGDLAAPPRLLVAPRPSDGNCQGNVLSLRHPRSDEETGYLFIDGQLHEFNWFKERF
GSWFLGDYVCEDGSLYYCTVVDPIFILLPILKAARMSNGKDPGKFRQLDEILYVEGYPGY
QHLMGIAGNHIDLVCEVKEVANVKFFRLDDSKVLSWLCCKVHNLKEVFPKLGKNYAAQGE
KELLKDAVQIIREYLNDEPWLTLLCKKLQLDIKEIIEANKTSEASFCAENSPVPFHPAEE
KLGSSSTRSSKGRPAKKQKAEVESKNIKDMFRRVTRKGT
NT seq 840 nt   +upstreamnt  +downstreamnt
atggcgtcgtggtgcggcgacctggctgcgccgccccgcctcctcgtcgcccctcgtcct
tctgatggcaattgtcaagggaatgttttgtctctccgccacccgagatcagatgaagaa
acagggtatctgttcatcgacggtcaacttcacgagttcaattggtttaaggagcgattt
ggatcttggttcttgggtgattatgtttgtgaagatggcagcctctactactgcacagtt
gttgatcccatttttattcttctaccaattttgaaagctgcacgtatgtcgaatggtaaa
gatccaggaaaatttaggcaactggatgaaatattgtatgttgaaggatatcctggatat
caacacctcatgggtatagcaggaaaccatattgatctggtctgtgaagttaaagaagtt
gctaatgtgaagttctttaggctggacgattccaaggtcttatcttggttgtgctgtaag
gttcacaatctaaaagaggttttccccaagctaggcaaaaattatgctgcccaaggagaa
aaagaattattgaaggatgccgtccaaataattcgcgaatacctgaacgacgaaccatgg
ttaacgttactctgcaagaagttgcagttggatatcaaggagatcattgaagcgaacaaa
actagcgaagcttccttctgtgcagagaattctcctgtacctttccaccctgctgaggag
aagcttggaagtagtagcactaggtcaagcaaagggaggccagcaaagaaacaaaaggct
gaggtagaatcgaagaacatcaaagacatgttccggagggtcacaaggaaaggaacgtga

DBGET integrated database retrieval system