KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267125
Entry
9267125           CDS       T01015                                 
Name
(RefSeq) ATP-dependent DNA helicase 2 subunit KU80 isoform X1
  KO
K10885  ATP-dependent DNA helicase 2 subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    9267125
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    9267125
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     9267125
SSDB
Motif
Pfam: Ku Ku_PK_bind Ku_N Ku_C VWA
Other DBs
NCBI-GeneID: 9267125
NCBI-ProteinID: XP_015631136
UniProt: Q75IP6
LinkDB
Position
3:36114048..36119597
AA seq 688 aa
MARNKEALVLLLDVGPSMHGVLQEVENICSTLVHKKLVYNRSDEIGVVLFGTKETSNELA
KELGGYKHVVVARDIKVVDEETTNALQNLPRGTSPGDFLDAIVVGLDMLIRKFGNIKGKQ
RMCLVTDAQHPLRDPPQGTKKDQVDTIADQMKRHEIKMDCIIFRESGVRHNAVMDENDQL
LYHFRERSVTKVVHVDSPTSLLGALRTRNVLPVTVFRGDLEVSSSFKIKVWVYKKTSEEK
FPTLKKYSDKAPASDKFASHEVKVDYEYKSVLEPDTVVPPDQRIKGYLYGPQVVPISSAE
WEAVKFKPEKGVKLLGFTDRSSISRHYFMKDVFSFVPEPGNTKAVAAVSALARAMSEMNK
VAILRCVWRQGQGNVALGVLTPNISSAKNVLDSFYFNILPFAEDIREFQFRSFSSLPSSS
QPTKEQQEAADNLVKMLDLAPPGREEILKPDFTPNPMLERFYRYLDLKSKQPDANVPPLD
KCLKKITEPDPDVIDYQAPLIKKLGNVFELKENPKKKKARTQDRLTYTGADDQAKLLEEP
SAEKVGVSEALYPPKKKAGEIGDHNPVQDFEAMLTQRSSSTWVQTAIEEMQKYITALIQD
SCDRDNHQKALECLVALRKACIIEQEPNEYNGFVTKLCQKFRPAGDKIFLQLLSSKKASL
ISKEEAPDSDVTEEMARNFCLKPEPSSQ
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggctcgcaacaaggaagcattggttttgctattggatgttggcccatccatgcatggc
gttctgcaagaagttgagaatatctgctccacccttgtgcataagaagctagtttataat
aggagtgatgagatcggtgttgtcctttttggaactaaagaaacaagcaacgaactcgcc
aaggagcttgggggctataagcatgtggtggttgctcgtgatattaaagttgttgatgaa
gaaacaacaaatgctctgcaaaaccttccaaggggaacttcccctggtgactttttggat
gctattgttgttggtttggatatgctgataagaaaatttggaaatatcaaaggaaaacag
cgtatgtgtctagtcactgatgcacaacatccattaagagatccaccccaagggacaaaa
aaggatcaggtggacactattgcagaccagatgaaaagacacgaaatcaagatggactgc
attattttcagagaatctggagttcgtcacaatgctgtaatggatgaaaacgaccaatta
ttataccacttcagagagaggtcagtaacaaaggtagttcatgttgacagcccaacgtca
ctcttaggtgctctcaggactagaaatgtacttccagttactgtcttcaggggagacttg
gaagtgagctctagctttaaaataaaggtgtgggtctataagaaaacatctgaggagaaa
ttccccactttgaagaagtattctgataaggctcctgcaagtgataaatttgcatctcat
gaagtcaaagtggattatgagtacaaaagtgttctagaaccagacacagtcgttccacca
gatcaaagaattaaaggatatctttatggtccacaagttgttcctatatcatccgctgaa
tgggaagctgtcaagttcaaacctgagaaaggtgtgaagcttctaggttttacagataga
tccagcatatctcggcactattttatgaaagatgtgttctcctttgttccggaaccagga
aacacaaaagcagttgctgccgtttctgccttagctagagcaatgagtgaaatgaacaag
gttgcaattttacgatgcgtgtggaggcaaggtcaagggaatgttgctttgggtgtattg
acaccaaacatatcatcagcaaaaaatgttctggattccttttacttcaatatacttcca
tttgctgaggacatcagagagtttcagtttcggtccttcagcagcctgccatcatcatct
cagcctaccaaggaacagcaggaagctgcagataacctggtaaagatgttagatcttgca
ccacctggaagggaagagatccttaagcctgatttcactccgaatcccatgttggagaga
ttctacaggtaccttgatctcaagtcaaagcagccggatgcaaatgtcccacccctcgac
aaatgtctaaagaagataactgaacctgatcctgatgtcattgattatcaagcaccgcta
ataaaaaaattaggcaatgtatttgagctgaaggagaaccccaagaaaaagaaagcacgg
acacaggacagattgacttatactggcgcagacgatcaggctaaattattagaagaacct
tctgcagagaaggttggggtttcggaagctttatatcctccaaaaaagaaggctggggag
attggcgatcataatcctgttcaagattttgaagccatgctgacacagagatctagctca
acgtgggttcagacggcaattgaagagatgcagaagtacataaccgctttaatacaggat
tcctgtgatcgggataatcaccaaaaggcactggagtgccttgttgctttacggaaggcc
tgcattattgaacaggaaccaaacgaatacaatggattcgtaacaaagctctgtcagaaa
tttaggccggctggtgataaaatttttttgcagcttctttcgtccaagaaagcttcgctt
ataagcaaagaagaagcacctgatagcgatgtgacggaagagatggcgagaaacttctgt
ctgaaacccgagccgtcctctcagtag

DBGET integrated database retrieval system