KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267465
Entry
9267465           CDS       T01015                                 
Name
(RefSeq) bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase
  KO
K12451  3,5-epimerase/4-reductase [EC:5.1.3.- 1.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    9267465
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    9267465
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-
     9267465
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-
     9267465
SSDB
Motif
Pfam: RmlD_sub_bind Epimerase GDP_Man_Dehyd Polysacc_synt_2 3Beta_HSD DHHW NAD_binding_4
Other DBs
NCBI-GeneID: 9267465
NCBI-ProteinID: XP_015627488
UniProt: B9F1T0 Q6EPQ1
LinkDB
Position
2:27709070..27713151
AA seq 311 aa
MGVATNGSSSSTSESAETAQSQAYKFLIYGRTGWIGGLLGQLCAARGIPFAYGAGRLENR
AQLETDIDEVAPTHVFNAAGVTGRPNVDWCETHRTETIRANVCGTLTLADVCRARGLVLI
NYATGCIFEYDAGHQLGTGIGFKEEDTPNFVGSFYSKTKAMVEELLKNYENVCTLRVRMP
ISSDLSNPRNFITKIARYDKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSH
NEILEMYRDYIDPNFSWKNFTLEEQAKVIVAPRSNNELDCTKLKAEFPELLSIKDSLVRY
VFKPNQKTSKA
NT seq 936 nt   +upstreamnt  +downstreamnt
atgggcgtcgccaccaacggctcctcctcctccacctcggagtcggcggagaccgcgcag
tcgcaggcgtacaagttcctcatctacggccggaccgggtggatcgggggcctgctcggc
cagctctgcgccgcgcggggcatccccttcgcctacggcgccgggcgcctcgagaaccgc
gcccagctcgagaccgacatcgacgaggtcgcgcccacccacgtgttcaatgccgcgggg
gtcaccggccgccccaacgtcgactggtgcgagacccaccgcaccgagaccatccgcgcc
aacgtctgcggcacgcttacgctcgccgacgtctgccgcgcccgcggcctcgtgctcatc
aactacgccacgggctgcatcttcgagtacgacgccggccaccagctcggcacagggatc
gggttcaaggaggaggacacgcccaacttcgtcggatcattctactccaaaaccaaggcc
atggttgaggaactgctaaaaaactacgagaatgtatgtacacttcgtgtaaggatgcct
atttcatccgatctatccaatcctcgcaacttcatcactaaaatcgcccggtatgataaa
gtggttgatataccaaattcaatgacaatattggatgagcttcttcctatctcaatcgaa
atggcaaagagaaacctcactgggatctggaatttcactaatcctggcgtggtgagccac
aatgaaatattggaaatgtatagggattacattgatccgaatttttcttggaagaacttt
accctggaggagcaagccaaggtcatagttgcaccgagaagcaataatgagcttgattgt
accaagctgaaggcggaatttccagaacttttgtcaatcaaggattctctggtaaggtat
gttttcaagccaaatcagaagacgtccaaggcttga

DBGET integrated database retrieval system