KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267485
Entry
9267485           CDS       T01015                                 
Name
(RefSeq) DNA primase small subunit
  KO
K02684  DNA primase small subunit [EC:2.7.7.102]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    9267485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    9267485
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.102  DNA primase AEP
     9267485
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    9267485
SSDB
Motif
Pfam: DNA_primase_S
Other DBs
NCBI-GeneID: 9267485
NCBI-ProteinID: XP_015638283
LinkDB
Position
5:complement(17006511..17011748)
AA seq 451 aa
MAREDEKADAMEIDGQHQQVANTAVPDGFNADYLRIYYGKLFPHVDFFKWLSYGNDGKHP
GCDQSYVGRREFSFTLENDIYVRFQSFDSVAEMENSIKEKCPFKIDIGPVYSVDPAKRHA
YAQSGNNVFVPVERELIFDIDISDYDDVRYCCSGADVCMECWPLMTIAIKILDASLRDDF
GFNHILWVYSGRRGVHCWVCDSRARKLNNEQRAAIADYFRVYKGGENTMKKVSLTGAVLH
PFLARSYTDVLKGFFEDKLLLSQQLFASEERYQKILDLIPDENVASELHDKWQGNRRSSI
SKEDVNATRWEQLKSTLQSGKHKGLRRCIEEIVFSYTYPRLDMEVSKHMNHLLKAPFCIH
PKTGRVCVPIDPNNCDDFDPTTVPTLSQLLGELNAAGLRTDSENDWERTSLEKSIRFFRA
SFLQPLLKACKEELESSYNAKLQQSKNTLTW
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggcgagagaggatgagaaggctgacgcaatggagattgatgggcagcatcagcaagtg
gccaacaccgccgtaccagatggcttcaatgctgattacctcaggatctactatggaaag
ctcttccctcatgttgatttcttcaagtggctttcatatggaaatgacgggaaacatcca
ggatgtgatcagtcgtatgttggacgtcgagagttctcatttacactagagaatgacatc
tacgttcgtttccagtcctttgatagcgtggctgaaatggagaactctatcaaggaaaag
tgccctttcaagattgatattggacctgtatatagtgtagatcctgcaaagcggcatgcc
tatgctcaatcaggcaacaacgtctttgtgccagttgagagagaacttattttcgatata
gatatatcagattacgatgatgttcgctattgctgctctggagctgatgtctgcatggag
tgctggcctttaatgaccattgctatcaaaatcttggatgcttcacttagagatgatttt
ggtttcaatcacatattgtgggtatatagtggtcgtcgtggtgtccattgctgggtttgt
gatagtagagcaagaaagctcaacaacgaacaaagggctgcaattgctgattattttcgc
gtctacaagggtggtgaaaatacgatgaagaaagtttcattgactggagctgttctccat
cctttccttgcacggtcatacactgatgttctgaaaggcttctttgaagataagctacta
cttagccaacaactatttgcatctgaggagagatatcagaaaatacttgatcttatccct
gatgaaaatgttgctagtgagctccatgataagtggcaaggaaacagacgatcttctatt
tcaaaggaagatgtaaatgctaccaggtgggagcaactaaagtcaaccttgcagtcagga
aaacacaaggggcttcgaagatgtatagaagagattgtcttctcatacacatatcctaga
cttgatatggaggtttctaagcacatgaatcatttgctgaaagcacccttttgcatacac
ccgaagacaggccgtgtttgtgttccaatcgatccaaataactgtgatgattttgatcct
acgacagttccaactctgtcacagcttttgggtgagctcaatgcagctggtcttcgtact
gattctgaaaacgattgggaaagaacatctcttgaaaaatctatcaggtttttcagggca
tcgtttctgcaaccattgctgaaagcctgcaaggaggaattagaaagctcatacaatgcc
aagctccagcagtccaagaataccttgacttggtaa

DBGET integrated database retrieval system