KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267714
Entry
9267714           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein At4g28440
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Other DBs
NCBI-GeneID: 9267714
NCBI-ProteinID: XP_015639112
UniProt: B9FK00 Q9FW37
LinkDB
Position
5:complement(71040..73344)
AA seq 134 aa
MADSGARRQPSFTKVDQLRPGTHGHNLLLKVVDSKMVLQRGGGPQGRHMRIAECLVGDET
GIIVFTARNDQVDVMKAGASVDLRNAKIDMFKGSMRLAVDKWGIVKAAESPADFTVKEDN
NMSLIEFELVTVVE
NT seq 405 nt   +upstreamnt  +downstreamnt
atggcggactccggcgctcgcaggcagcctagcttcaccaaggtcgaccagctccgccct
gggacccatggccacaaccttctcctcaaggtcgtcgactccaagatggtccttcagagg
ggcggaggccctcagggcaggcacatgcggattgccgagtgcctcgtcggcgatgaaacc
ggcattattgtcttcaccgcaaggaacgaccaggtggatgtaatgaaggctggggctagt
gttgacctgaggaatgccaagattgatatgttcaaggggtcgatgcggcttgcggtggac
aagtgggggattgtgaaagctgctgaaagcccagctgatttcacagtgaaggaggataac
aacatgtccttgatcgagtttgagctggtgacagtggtggagtga

DBGET integrated database retrieval system