KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267792
Entry
9267792           CDS       T01015                                 
Name
(RefSeq) anaphase-promoting complex subunit 6
  KO
K03353  anaphase-promoting complex subunit 6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9267792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    9267792
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    9267792
   03036 Chromosome and associated proteins [BR:osa03036]
    9267792
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     9267792
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     9267792
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    9267792
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_8 ANAPC3 TPR_12 TPR_14 TPR_16 TPR_7 TPR_19 TPR_10 TPR_11 TPR_3
Other DBs
NCBI-GeneID: 9267792
NCBI-ProteinID: XP_015628394
UniProt: B9F6N8
LinkDB
Position
3:7212538..7221252
AA seq 577 aa
MWDTKFGFPPAAPPTTAAAAQKNPKRRREAEAEGEVAAEMREEAVERLRGVVRDSVGKHL
YASAIFLADKVAAATGDPADVYMLAQALFLGRHFRRALHILNSSKLLRDLRFRFLAAKCL
EELKEWHQCLIILGDAKIDEHGNVVDQDDGSDIYFDKDAEDHEINIKAAICFLRGKAYEA
LDNCDLARQWYKAAVKADPLCYEALECLVDNYMLTCEEESELLSSLKFGKEDGWLSAFYS
CLIRKHEKEYIVEAKFKEFERESCSISSLSSGLTLKNNIDVLACKAEYYHQSGEYQKCFE
LTSALLERDPFHLKCTLVHLAAAMELGHSNDLYILACNLVKDYPQKALSWFAVGCYYYCI
KKYDQARRYFGKATGLDGTFPPAWIGTGIAYAAQEEGDQAMAAFRTAARLFPGCHLPTLY
MGMQYLRMHNFKLAEQFFTQAKSICPSDPLIYNEMGVVAYNMKEYQKAVQWFELTLEHTS
SSLNEMWEPTLVNLGHALRKLKKYQKAISYYEKALTFQTKSLSAFAGLAYTYHLMDKFEA
AITYYHKALWLKPDDQFSTDMLTLALESSCQITARTR
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgtgggatacaaaattcggtttccctccagcagcgccgcccaccaccgccgccgcagcg
cagaaaaatcccaagcggaggagagaggcggaggcggagggggaggtggcggcggagatg
agggaggaggcggtggagcggctgcgcggggtggtgcgggacagcgtcgggaagcacctg
tacgcgtccgccatcttcctcgccgacaaggtggccgcggccacgggggaccccgccgac
gtctacatgctcgcgcaggcgctcttcctgggccgccacttccgccgcgcgctccacatc
ctcaactcctccaagctcctccgcgacctccgcttccgcttcctcgcagccaagtgcctc
gaggagttgaaagaatggcatcagtgtttgatcatacttggagatgcaaaaatagatgag
catggaaacgttgttgatcaggatgatggcagtgacatttactttgataaggatgctgaa
gaccatgagatcaatatcaaagcggcaatatgttttttacgtggcaaggcatacgaagca
ctggacaactgtgaccttgctcgacaatggtacaaagctgcagtgaaggctgatcctttg
tgctatgaggcccttgaatgccttgttgataactacatgttgacatgcgaggaagaatct
gagctattgtcctctctaaaatttggaaaagaagatgggtggctctcagcattctactct
tgtttgataaggaagcatgaaaaagaatatatagtggaagcaaagttcaaggaatttgaa
cgagaatcttgtagtatttcatctttgagttcaggactgacactgaaaaataatattgac
gtgttggcttgcaaagctgaatactatcatcagagtggagagtaccaaaaatgtttcgaa
ctcacatctgcgttacttgaaagggacccttttcatttgaaatgcacgttagttcatttg
gcagctgcaatggagcttggccattcaaatgacctttatattttggcctgcaatctagtg
aaggactatcctcagaaagctctttcctggtttgctgttgggtgttattactactgtatt
aagaagtatgatcaagcacgcagatactttggcaaagctacagggttagatgggacattt
cctcctgcttggattggtactggtattgcttatgctgcacaggaggagggtgatcaagca
atggctgcatttcggacagcagctcggctatttcctggatgtcatctgccaactttatac
atgggcatgcaatatttgcgaatgcacaatttcaaacttgcagagcagttcttcacgcaa
gcaaaatctatctgcccatctgatccgcttatatataacgagatgggggttgtagcttat
aatatgaaagagtatcaaaaagcagttcagtggtttgagctaacactggagcatacttca
tcctccttgaatgaaatgtgggaaccaacattggtgaatcttgggcatgcattgcggaaa
ctcaagaaatatcaaaaggcaatatcatattatgaaaaggcactcacctttcaaaccaaa
agtttgagcgcgtttgctggtcttgcttatacttaccaccttatggataaattcgaggct
gcgataacttactaccacaaggctttatggttgaaaccagacgatcaattctccacagac
atgctaacgttagccctcgagtccagctgtcaaatcactgctcggacaagatag

DBGET integrated database retrieval system