KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269112
Entry
9269112           CDS       T01015                                 
Name
(RefSeq) hydroxyethylthiazole kinase
  KO
K00878  hydroxyethylthiazole kinase [EC:2.7.1.50]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00730  Thiamine metabolism
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00899  Thiamine salvage pathway, HMP/HET => TMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    9269112
   00740 Riboflavin metabolism
    9269112
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.50  hydroxyethylthiazole kinase
     9269112
SSDB
Motif
Pfam: HK Phos_pyr_kin Carb_kinase DUF1769
Other DBs
NCBI-GeneID: 9269112
NCBI-ProteinID: XP_015611592
LinkDB
Position
1:complement(14802767..14804514)
AA seq 283 aa
MDEERTAAWWGRRAWELLSAVRARAPLVHCVTNLVSMDIAANALLAAGASPAMVHSLREV
PEFTPRCDAVCVNVGTLSEGWLPSMRAAASAGRPWVLDPVAAAASEFRMEACLSLLALRP
AVVRGNASEILALASRSLAASSSSSTTTFKGADSTHDSGDALQDAKALARSTGAVIAVSG
AVDYVTDGERVVGVSNGVAMMQKITATGCAATALIAAFLAVVEEPSDAMAAAACALAVFG
LAGEIGMESGAKGPASLRMHLIDALYCLDVQTVTSRVKISLHS
NT seq 852 nt   +upstreamnt  +downstreamnt
atggacgaggagcggacggcggcgtggtggggccggcgggcgtgggagctcctctcggcg
gtgcgggcgcgggcgccgcttgtgcactgcgtcaccaacctcgtctccatggacatcgcc
gccaacgcgcttctcgccgcgggggcgtcgccggccatggtccactccctccgcgaggtc
ccggagttcaccccgcgctgcgacgccgtgtgcgtcaacgtcggcacgctgtccgagggc
tggctcccctccatgcgcgccgccgcctccgcgggccgcccctgggtgctcgaccccgtc
gccgccgccgcctccgagttccggatggaggcctgcctctccctcctcgccctccgcccc
gccgtcgtcagggggaacgcgtcggagatccttgccctcgcctctcgctcgctcgccgcc
tcctcctcctcctccaccaccaccttcaagggcgcggacagtacacatgattcaggggac
gctcttcaagatgcaaaagcactggcacggtccaccggtgccgtcatcgcggtgtccggg
gccgtcgattacgtcaccgacggcgagcgggtggtcggagtgagcaacggcgtggccatg
atgcagaagataacggcgacgggctgcgccgcgacggccctcatcgcggccttcctcgcg
gtggtggaggagccttccgacgccatggccgcggcggcgtgcgcccttgctgtctttggc
ctggccggggagatcgggatggagtctggcgccaagggacccgcctctctcaggatgcat
ctcatcgatgctctctactgcctcgacgtgcagacggtgacctctcgagtcaagatctcc
ctgcattcgtga

DBGET integrated database retrieval system