KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269735
Entry
9269735           CDS       T01015                                 
Name
(RefSeq) putative dihydroflavonol-4-reductase
  KO
K15891  NAD+-dependent farnesol dehydrogenase [EC:1.1.1.354]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa00909  Sesquiterpenoid and triterpenoid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    9269735
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    9269735
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.354  farnesol dehydrogenase (NAD+)
     9269735
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 NAD_binding_10 NmrA Polysacc_synt_2 RmlD_sub_bind Glyco_trans_4_4 Semialdhyde_dh KR
Other DBs
NCBI-GeneID: 9269735
NCBI-ProteinID: XP_015632474
UniProt: A0A0P0VTV5 Q94HG6
LinkDB
Position
3:4441956..4443844
AA seq 341 aa
MRIAVTGATGYLGSRLCGALADAGHAVRAFALRSAGGGGGGGDVEAGLLPASVELAYGDV
ADVESLAAAFDRCDAVFHVAAAVEAWLPDPSIFITVNVGGLENVLKAARRTPTVKKIVYT
SSFFAIGPTDGYVADETQMHQGKTFCTEYEKSKVLADQIALQAAAEGMPITIVYPGFMYG
PGKLTAGNLVSRILIERFNGRLPGYVGHGHDRESFCHVDDVVAGHVAAMEKGREGERYLL
TGENTSLVQIFDMASRITNTKAPRFHVPLWLLEIYGWISVLVSRITGKLPFISYPAVRVL
RHQWAYSCEKAKKELGYSPRSLTEGLSETLLWLKDSEMIRF
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaggatcgcggtgacgggcgcgacggggtacctcggcagccgcctgtgcggtgcgctg
gccgacgccggccacgccgtgcgcgcgttcgcgctccgctcggcgggcggcggcggcggc
ggcggcgacgtcgaggccggcctgctcccggcgtccgtcgagctggcgtacggcgacgtc
gccgacgtggagtccctcgccgccgccttcgacaggtgcgacgccgtcttccacgtcgcc
gccgccgtcgaggcgtggctgcccgatccctccatcttcatcacggtcaatgtgggaggg
ctcgagaatgttttgaaagctgccaggaggacaccaacagtaaagaaaatagtttatacg
tcatcattctttgccattggcccaactgatggatatgttgcagatgagacacagatgcat
caaggaaaaacattttgcacggagtatgagaaatcaaaggttcttgcagaccagatcgca
ttgcaggcagcagcagaggggatgccaatcaccatcgtctatccaggattcatgtatggt
cctggaaaacttacagcaggaaatcttgtttctcgcatcttgatcgagaggttcaatggg
cgtttacctggttacgtcgggcatggccatgatcgagaatcattctgccatgtcgacgat
gttgttgctggacatgtagcagcaatggagaaaggcagagaaggtgaaagatacctcctc
accggagagaacacgtcgctggttcagatcttcgacatggcctccaggatcacgaacaca
aaggcgcccagattccacgtacccctctggttgcttgaaatttacgggtggatttcagtt
cttgtttcaagaatcaccgggaagctcccgttcatcagctaccctgcagtgcgtgttctt
aggcatcaatgggcatactcatgtgagaaggccaagaaggagctagggtacagtcctagg
agcttgactgaaggtctatcagagacgctcttatggctcaaggacagcgaaatgatcaga
ttttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272175
Entry
9272175           CDS       T01015                                 
Name
(RefSeq) putative dihydroflavonol-4-reductase
  KO
K15891  NAD+-dependent farnesol dehydrogenase [EC:1.1.1.354]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa00909  Sesquiterpenoid and triterpenoid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    9272175
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    9272175
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.354  farnesol dehydrogenase (NAD+)
     9272175
SSDB
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 NmrA Polysacc_synt_2 RmlD_sub_bind adh_short Semialdhyde_dh
Other DBs
NCBI-GeneID: 9272175
NCBI-ProteinID: XP_015632475
LinkDB
Position
3:4444018..4446472
AA seq 336 aa
MGGGMRVVVTGATGYLGGRLCAALAAAGHAVRAFARRSSDASGLPASVELAYGDVTDEGS
LATAFDGCDAVFHVAAAVEPWLPDPSVFTTVNVRGLENVLKAAKRTPTVKKIIYTSSFFA
IGPTDGYVADETQRHQEKTFCSEYEKSKVLADRIALQAAAEGVPITILYPGVIYGPGKLT
TGNIVSRILIERFNWRLPGYIGDGYDRESFCHVDDVVNGHIAAMEKGRPGERYLLTGENL
SFKQIFDMAANITNTKAPLFHVPLWLIEIYGWISVFISHITGNLPLISYPTVRVLRHQWA
YSCDKAKRELGYSPRNLTEGLSEMLLWLKDEKLIKF
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgggcggcggcatgagggtggtggtgacgggcgcgacggggtacctcggcggccgcctg
tgcgcggcgctggcggccgccggccacgccgtgcgcgcgttcgcccgccgctccagcgac
gcctccgggctcccggcatccgtcgagctggcctacggggacgtcaccgacgaggggtcc
ctcgccaccgccttcgacgggtgcgacgcggtcttccacgtcgccgccgccgtcgagccg
tggctccccgacccctcggttttcaccaccgtcaatgtgagaggactcgagaatgtgttg
aaggctgctaagagaacaccgaccgtaaagaagataatttacacatcttcattctttgca
attggcccaactgatggttatgttgcagatgagacacagagacatcaagagaaaacattt
tgctcagagtacgagaaatccaaggttcttgcagaccgaattgcattgcaggcagcagca
gaaggggtgccaatcaccattctctaccctggagttatctacgggcctggaaaactaact
actggaaatattgtttcccgtattttaattgaacggtttaattggcgcctacctggttac
ataggagatgggtatgatagggaatcgttttgccatgttgacgacgttgttaatgggcac
atagcagcaatggagaagggcagaccgggggaaagatatctccttactggagaaaactta
tcattcaaacagattttcgatatggctgctaacattacaaatacgaaggcacccctattc
catgtacctctctggttgattgaaatatatgggtggatttcagtttttatttctcacatc
actggaaatctcccacttatcagttaccctacagtacgtgttcttagacatcaatgggca
tattcatgtgataaagccaagagggagctgggctacagtccaagaaacttaactgaaggt
ctatcagagatgctcttatggctcaaggatgaaaaattgatcaagttttag

DBGET integrated database retrieval system