KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270233
Entry
9270233           CDS       T01015                                 
Name
(RefSeq) D-lactate dehydrogenase [cytochrome], mitochondrial
  KO
K00102  D-lactate dehydrogenase (cytochrome) [EC:1.1.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    9270233
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.4  D-lactate dehydrogenase (cytochrome)
     9270233
SSDB
Motif
Pfam: FAD-oxidase_C FAD_binding_4 Pneumo_matrix
Other DBs
NCBI-GeneID: 9270233
NCBI-ProteinID: XP_015644610
LinkDB
Position
7:complement(3362946..3370073)
AA seq 558 aa
MATAAAALLRLSRSRRPLLPLSSLRLPPPAPYHHHSHSQTPPSSSSSHARLPAFLSFLAA
AAAAGGTTVALCDSGIDHRVGGKESTELVVRGERKRVPNEFIDELASFLGENLTVDYEER
HYHGTPQNSFHKAVNVPDVVVFPRSQDEVQKIVMACNKYKVPIVPYGGATSIEGHTLAPH
GGVCINMSLMKKIKSLHVEDMDVVVEPGVGWIELNEYLKPYGLFFPLDPGPGATIGGMCA
TRCSGSLAVRYGTMRDNVINLQAVLPNGDVVKTGSRARKSAAGYDLARLIIGSEGTLGVI
TEVTVRLQKLPSHSVVAMCNFQTIKDAADVAIATMLSGIQVSRVELLDEVQIRAINMANG
KNLPEVPTLMFEFIGTEAYALEQTLLVQKIATEHHGSDFVFVEELDAKEELWKIRKEALW
AGFAMKPDHEAMITDVCVPLSRLAECISVSKEKLDASPLTCLVIAHAGDGNFHTIILFDP
SQEDQRREAERLNHFMVHTALSMEGTCTGEHGVGTGKMKYLEKELGIESLRTMKRIKAAL
DPNNIMNPGKLIPPQVCI
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggccaccgccgccgccgcgctcctccgcctctcccgctcccgccgcccgctcctcccc
ctctcctccctccgcctcccgcctcccgccccgtaccaccaccactcccactcccaaacc
ccaccctcctcctcctcctcccacgcccgcctccccgccttcctctccttcctcgccgcc
gccgccgccgccggaggaacgaccgtcgccctctgcgactccggcatcgaccaccgggtc
gggggcaaggagagcaccgagctggtggtgcgcggggagcggaagcgcgtgcccaacgag
ttcatcgacgagctcgcttccttcctcggggagaacctgacggtggactacgaggagagg
cactaccatggcacgccgcagaacagcttccacaaggcagtcaatgtgcccgatgtcgtc
gtcttcccgaggtcccaggatgaggtacagaagattgtgatggcttgtaacaagtacaag
gtgccaattgtaccatatggtggggctacatcaattgagggtcacacgttggcacctcat
ggtggtgtttgcattaacatgtctttgatgaagaaaatcaaatccctgcatgttgaggat
atggatgtagttgttgaaccaggagttggatggattgagctgaatgagtacctgaaacca
tatggcctctttttccctcttgacccagggcctggggccactattggaggaatgtgtgct
actcgctgttctggttcactagctgtgaggtacggaacaatgcgggacaatgtgattaac
ctccaggctgttctacctaatggtgatgttgtcaagacgggttctcgagcccgaaagagt
gcagctggatacgatcttgctcgtttgatcattggaagtgaaggaactttaggggtaatt
acagaagtgactgtacgtcttcaaaagcttccatctcattccgtggttgcaatgtgcaat
tttcaaacaattaaggatgctgctgatgttgctattgcaacaatgctttctggtatacag
gtctcaagagtggaattgttggatgaggttcagataagggcaattaacatggcaaatggt
aaaaacttacctgaagtaccaaccttgatgttcgaattcatagggacagaagcctatgct
cttgaacaaacactattggttcaaaagattgccacagaacaccatggatctgattttgtt
tttgtagaagagctggatgctaaagaggagttatggaagattaggaaggaagcactttgg
gccggttttgccatgaaacctgatcatgaggctatgataacggatgtttgtgttcctttg
tctagacttgcagaatgcatatctgtctcaaaggaaaagcttgatgcatcaccattgact
tgtttggttatcgctcatgctggtgatggaaacttccacacaataatcctatttgaccct
agtcaagaagaccaacgacgtgaagcggagaggctaaaccatttcatggttcatactgct
ctctctatggaaggtacctgtacaggagagcatggtgtaggtacagggaaaatgaagtac
ctagagaaagagctgggcatcgagtcgctaaggacgatgaaaagaataaaggctgcgttg
gatcccaacaatatcatgaatccagggaaactgattccacctcaagtctgcatttga

DBGET integrated database retrieval system