KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270735
Entry
9270735           CDS       T01015                                 
Name
(RefSeq) alpha-N-acetylglucosaminidase
  KO
K01205  alpha-N-acetylglucosaminidase [EC:3.2.1.50]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00531  Glycosaminoglycan degradation
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    9270735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9270735
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.50  alpha-N-acetylglucosaminidase
     9270735
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9270735
SSDB
Motif
Pfam: NAGLU NAGLU_C NAGLU_N
Other DBs
NCBI-GeneID: 9270735
NCBI-ProteinID: XP_015635447
UniProt: Q7XMP5
LinkDB
Position
4:complement(33170226..33179390)
AA seq 829 aa
MPAPRLLRVLLLLVALACATSGVGCSDPRFPHLGRVRELHRGEGRPAAEQEAAARGLLAL
LLPSHSGSFDFRVISADQCGGKACFIVDNHPLFDGEGTPQVLLLGTSGVEISAGLHWYLK
HYCAAHVSWDKTGGAQLSSVPRPGSLPRLPSGGILIQRPVGWSYYQNAVTSSYSFAWWDW
ERWEKEIDWMALQGINLPLAFTGQEAIWQKVFQRYNISKSDLDDFFGGPAFLAWSRMANM
HGWGGPLPQSWLDDQLALQKKILSRMYAFGMFPVLPAFSGNIPAALRSKFPSAKVTHLGN
WFTVDSNPRWCCTYLLDASDPLFVEIGKLFIEEQIREYGGTSHVYSCDTFDENTPPLSDP
NYISSLGAATFRGMQSGDDDAIWLMQGWLFSYDPFWEPPQMKALLHSVPVGRMIVLDLYA
EVKPIWINSDQFYGVPYIWCMLHNFAADFEMYGVLDMVASGPIDARLSANSTMVGVGMSM
EGIEQNPIVYDLMSEMAFHHRQVDLQVWVETYPTRRYGKSMVGLQDAWKILYQTLYNCTD
GKNDKNRDVIVAFPDVEPFVIQTPGLYTSSSKTYSTKLSKNYIAVDASNDEYEHPHLWYD
TDAVIRALELFLRYGDEVSDSNTFRYDLVDLTRQTLAKYANQVFVKIIESYKSNNVNQVS
NLCQHFIDLVNDLDTLLASHEGFLLGPWLESAKGLARDKEQEMQYEWNARTQITMWFDNT
KTKASLLRDYANKYWSGLLRDYYGPRAAIYFKYLILSMEKKEPFALEEWRREWISLTNNW
QSDWKVFPTTATGDALNISRTLYKKYLHDADLIQPEGIIRLRNLKNTPW
NT seq 2490 nt   +upstreamnt  +downstreamnt
atgccggctccccgcttactccgggtgctcctgctgctcgtcgcgctagcctgcgccacg
tcgggggtcgggtgctccgacccgcggttcccgcacctcggccgcgtccgggagctccac
cgcggggagggtcgccccgcggccgagcaggaggccgcggcgcgcgggctcctagcgctc
ctccttccgtcgcactccgggagcttcgatttcagggtcatctccgcggaccaatgtggt
ggaaaggcatgcttcattgtggacaaccatccattgtttgatggagaagggactccacaa
gtacttttacttggaacaagtggggtagaaatctctgctggtcttcattggtacttgaag
cactactgtgcagcacatgtatcatgggataaaactggtggtgcacaattatcatcagtg
ccacgtcctggctcactacctcgtcttccttctggtggcattttgattcaaagacctgtt
ggctggagctactaccagaatgcagttacatccagttattcttttgcttggtgggattgg
gagcgctgggagaaggaaattgactggatggctcttcaaggtatcaatttgcctcttgct
ttcactggtcaagaagctatatggcagaaagtttttcagaggtacaacattagtaaatca
gacctggatgatttctttggcgggccagcatttcttgcatggtctcggatggccaatatg
catggatggggcggacctcttcctcaaagctggcttgatgatcagctagctcttcagaag
aaaatcctttctaggatgtatgcttttggcatgttcccagttcttccagccttttctggt
aacatcccggccgcactaagatcaaaatttccttcagctaaagttactcaccttgggaac
tggttcacagttgacagcaaccccaggtggtgttgcacatatcttctggatgcatctgat
cccttatttgtagaaattgggaagctttttattgaagaacaaatcagagaatatggtggg
acaagtcatgtgtacagctgtgatacttttgatgagaacacccctccgctaagcgatcca
aattatatctcttcgttgggtgctgcaacattccggggaatgcaaagcggtgatgatgat
gctatttggttaatgcaaggttggttgttttcttatgatcctttctgggaacccccacaa
atgaaggcactgctgcattctgttccagttggccgaatgattgttcttgatctatatgca
gaagtgaaaccaatatggatcaactctgatcagttttatggtgtcccttacatctggtgc
atgcttcataattttgctgcggactttgaaatgtacggtgttttggatatggttgcttct
gggccgattgatgctcgactaagtgcgaactctacaatggttggagttggcatgtctatg
gaaggtattgagcaaaatcctattgtttatgacctgatgtcggaaatggcctttcatcac
agacaagtggatctacaggtgtgggttgagacatatccaacaagaagatatgggaagtca
atggtggggctgcaagatgcttggaaaattttataccaaactctttataattgcacagat
ggtaaaaatgacaaaaatagggatgtgatagtggcattcccagatgttgaaccttttgtt
attcaaacaccaggattgtatacaagtagtagcaaaacgtattcgacaaagttatctaag
aattacattgcagtggatgcatccaatgatgaatatgaacatccacatctatggtatgac
accgatgctgttatacgtgccctagagctttttcttcgatatggagatgaagtatctgac
agcaataccttcaggtatgaccttgtggatttaactcgtcaaactctggctaaatatgcc
aaccaggtctttgtaaagatcattgaaagctacaaatcaaacaacgtgaaccaagtgagc
aatctctgtcagcacttcattgaccttgttaatgacctagacacactgttggcctcccat
gagggatttcttcttggcccttggttggaaagtgccaagggtcttgccagagataaagag
caagaaatgcagtatgagtggaatgctcgaacacaaattacgatgtggtttgacaacacc
aaaacgaaagctagcctgcttcgtgattatgcaaataaatactggagcggcctgctgcga
gactactatggaccaagggctgccatctacttcaagtacttaatattgagcatggagaaa
aaagaaccttttgctctggaggaatggaggagggaatggattagcctcacaaacaactgg
cagagcgattggaaggtctttccaaccacagctacgggagacgctctgaacatctcccgg
acactttacaagaagtacctgcacgacgctgacttaattcagccagaaggtattatacga
ctgcgaaatttgaagaatacaccttggtaa

DBGET integrated database retrieval system