KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270776
Entry
9270776           CDS       T01015                                 
Name
(RefSeq) ATP synthase delta chain, chloroplastic
  KO
K02113  F-type H+-transporting ATPase subunit delta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    9270776
   00195 Photosynthesis
    9270776
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    9270776
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   9270776
SSDB
Motif
Pfam: OSCP DUF1539 Ala_racemase_N
Other DBs
NCBI-GeneID: 9270776
NCBI-ProteinID: XP_015626374
UniProt: Q6Z8K7
LinkDB
Position
2:31526903..31528530
AA seq 243 aa
MATLRLTSVTLRPAASPSSAAAPRSANFARAAARGFPSLRLAPPRRRGDLARRRAAADAA
AEGYATALSEVASENGTLEATVSDLEKLEKIFAEEAIAEFFDNPTVPRDEKAQLIDEIAK
SSELQAHVVNFLNVVVDNGRAGLMTQIVREFENAFNSLTGTEVATVTSVVQLESQDLAQI
AQQVQNLTGAKNVRVKTRIDPELIAGFTIQYGRDGSSLIDMSVRKQIEEITSEFEMPAVT
LDV
NT seq 732 nt   +upstreamnt  +downstreamnt
atggccaccctccgcctcacctccgtcaccctccgccccgccgcctccccctcgtccgcc
gccgcgccgcggtccgccaacttcgcccgcgccgcggcgcgcgggttcccctcgctccgc
ctcgcgccgccgcgccgccgcggggacctcgccaggcgcagggccgccgccgacgccgcg
gcggaggggtacgcgacggcgctgtccgaggtggcctcggagaacggcacgctcgaggcg
accgtgtcggacctggagaagctggagaagatcttcgcggaggaggccatcgccgagttc
ttcgacaacccgacggtgccgcgcgacgagaaggcccagctcatcgacgagatcgccaag
tcgtcggagctccaggcgcacgtcgtcaacttcctcaacgtcgtggtggacaacggccgc
gcgggcctcatgacgcagatcgtgcgggagttcgagaacgccttcaactcgctcaccggc
accgaggtggccaccgtcacctccgtcgtgcagctcgagtcgcaggacctcgcgcagatc
gcgcagcaggtgcagaatctcaccggcgcgaagaacgtccgggtcaagacccgcatcgac
ccggagctcatcgccggcttcaccatccagtacggccgcgacgggtccagcctcatcgac
atgagcgtccggaagcagatcgaggagatcacctccgagttcgagatgcccgcagtaacc
ctcgacgtctga

DBGET integrated database retrieval system