KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272161
Entry
9272161           CDS       T01015                                 
Name
(RefSeq) dolichol-phosphate mannosyltransferase subunit 3
  KO
K09659  dolichol-phosphate mannosyltransferase subunit 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    9272161
SSDB
Motif
Pfam: DPM3 Gpr1_Fun34_YaaH DUF5693
Other DBs
NCBI-GeneID: 9272161
NCBI-ProteinID: XP_015626760
UniProt: B7F922
LinkDB
Position
2:complement(31495938..31498887)
AA seq 89 aa
MKHIFKIIAMLVAVSAIWIALLETATVPRSYTWLLPIYLVVALGCYGLFMVGFGLMFFPT
CPQEAVLLQQDILEAKEFLSKKGVDVGSE
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagcacatattcaagataattgctatgctggtggcagtctcagctatttggattgcc
cttcttgaaaccgcgactgttcctcgaagttatacttggttgcttcccatctacttggta
gtggcacttggatgctatggcctttttatggttggatttgggcttatgttcttcccaact
tgcccgcaagaagctgtactactacagcaggatatcttggaggcaaaggaattcctatca
aagaaaggtgttgatgttggctctgaataa

DBGET integrated database retrieval system