KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272338
Entry
9272338           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: REPA_OB_2 Rep_fac-A_C DUF223
Other DBs
NCBI-GeneID: 9272338
NCBI-ProteinID: XP_015647710
LinkDB
Position
7:13293853..13304108
AA seq 574 aa
MGGLQIASLEPGDGNPTLRIRISRLWEYRDQNDESILHYIGLVLVDQKGSSIAAMIYPPC
DNKFKPLITEGKVYLLTYYRVKPCTKHYRPVDNKLAITFTWWSTVEECVDVPDNFAQYAY
SLKPFNELRSHVDRKDSFTDVIGIITEISSVTTVQTRIKDGDSLKRNVYIRNADNETTNI
ALWGERATSFPADEIVSAGKHQPQIVIFVGTLVRGHGRNVSLSGNSACKWYINIDTPEVK
SLAASVEGSYEPIKWLDLPSGPAAHNNGEEKTIAEIRELHPFKFKKHEFLVTVVIKKLNM
EYSWWYTACDICKKTAKPYGSSYRCGNNTCPPVVSASPWFKLSVIAGDHTADTTFIVFGR
LAQRLIGRSVDALVMENPTGKDYIPREITDLLEKEFVWNVSFTENTVSSGIVAFQVNKII
KGGQNYSLALLQSPSGSQASSVVPSMALSPVTSQDVSVGQHTETETPSVGFVDAQLPLVS
PSTATQKDKNIDDEFASKTPGEDVAADDEDYDQDDEHLNLTQKAPGSAAKSTTSKAYKKR
PRPSPGTGAAKKLFKGNDADSTDDAAGSSAIKKT
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgggcggcctgcagattgctagccttgagcctggtgatgggaatccaactctccgcata
cgcatttcacggttatgggaataccgtgaccaaaatgatgaaagtatcttgcactatatt
ggcttggttttggttgatcaaaagggatccagcattgctgctatgatttatcctccatgc
gacaacaaatttaagcccctcatcactgaaggcaaggtatacttgcttacgtactatcgt
gtgaaaccttgcacgaagcactaccggccagttgacaacaaactggcgatcactttcact
tggtggagtacagtggaagaatgtgttgatgtgccagataactttgctcagtatgcttac
tcccttaagccttttaatgagctacgctcccatgtggacaggaaagactccttcacagat
gttattggaatcatcactgaaatatcatctgttacaaccgttcagacacgcattaaagac
ggtgatagcttgaaaaggaacgtctacatccgcaatgctgacaatgagacaaccaatatt
gcattgtggggagaaagggctacaagctttcctgcagatgagattgtcagtgcaggcaag
catcaaccgcagatagttatctttgttggcacattggtgagaggccatggaagaaacgtt
tctctgtcaggtaactcggcatgcaaatggtacataaatattgacacaccagaggtcaaa
tccttggctgctagtgttgaagggagctatgagccaataaaatggcttgatctgccgtct
ggacctgctgcccacaacaatggtgaagaaaagacaattgctgagatcagagaacttcac
ccttttaagttcaagaaacatgagttcttggttactgtggtcatcaaaaaacttaacatg
gagtattcctggtggtatactgcttgtgatatctgcaagaagacagcaaaaccatatgga
agttcttatagatgtggaaacaacacatgcccaccagttgtttcagcttcaccttggttc
aaactgagtgtgatagcaggagatcatacagccgacactacatttattgtttttggccgt
ttggctcaaaggctcattggtcgttcagttgatgcactggtgatggagaatccaaccggc
aaggactacataccgagagagatcactgatcttcttgagaaagaatttgtctggaatgtc
agctttacagagaacacagtttctagcggcattgtagctttccaagtgaacaagattatt
aaaggaggccagaattattccttggctcttctacaatctccatctggatcccaagcatct
tctgtggtaccttccatggccctatctccagttacatctcaggatgtttctgttggtcag
cacacagagacagaaactccatcagtagggtttgttgatgctcagctacctctggttagc
ccatccaccgctacacaaaaagataagaatatagacgatgagtttgcatcaaagacccct
ggagaggatgtggctgctgatgatgaagactatgaccaggatgatgagcatctcaacctt
acacagaaggctcctggttctgcagctaaaagcaccacttccaaggcatacaaaaagagg
cccagaccatctcctggaaccggtgcagctaagaagttgttcaagggcaatgatgctgac
agtactgatgatgctgctggaagcagtgccatcaagaagacctag

DBGET integrated database retrieval system