KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272428
Entry
9272428           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L19-2, chloroplastic
  KO
K02884  large subunit ribosomal protein L19
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9272428
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9272428
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    9272428
  Bacteria
    9272428
SSDB
Motif
Pfam: Ribosomal_L19 DUF3857
Other DBs
NCBI-GeneID: 9272428
NCBI-ProteinID: XP_015623685
UniProt: Q6H8H3 C7IYA7
LinkDB
Position
2:complement(26317510..26320423)
AA seq 234 aa
MAAAAAAAASATAAISGALLPHAVACHRLPPRPQLLAVSSSFRRLSLTASPRRASRLVPR
ADASAEAGEPEPAAEAEAEAVAASTDAEVEEGEAEAAVAVAEEEQEEEDEPPPPSKPPVK
FGEIIGILNKQFIEEAEKVKTLPDLRPGDIIELRMQRPNKRRLSLFKGIIIAKHKSGVHT
TIRVRRIIAGVGVEITFPIYSPRIKEIKVIRHKKVRRAKLYYLKHKLPRFSTFK
NT seq 705 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgccgccgccgcctccgccaccgccgccatctccggtgcgttactc
ccccacgccgtcgcatgccaccgcttgccgccgcggccgcagctcctcgcggtgtcctcc
tcattccgccgcctctccctgaccgcctcccctcgccgggccagccgcctggtccctcgc
gcggacgccagcgcagaagcgggagaaccggagcccgccgctgaggctgaggctgaggct
gttgctgcctcgactgacgctgaggtggaggagggtgaggcggaggcggctgtcgcggtg
gcggaggaagagcaggaggaagaagatgagcctccgccgccgagcaagcccccggttaag
ttcggggagatcattgggattctgaacaaacagttcattgaggaggctgaaaaggtgaag
actttaccagatcttaggcctggtgacatcattgagcttagaatgcaacggcccaacaag
aggagattgtcgctctttaagggcataattatagcaaaacacaaatctggtgttcacacc
acaatccgtgtcagaaggattattgctggtgtcggagttgagattaccttccctatatat
tcacccaggatcaaggaaattaaagtaatcaggcacaagaaagtgagaagagcaaagtta
tattatttgaagcacaagcttccccgcttttcaactttcaagtaa

DBGET integrated database retrieval system