Ostreococcus tauri: OT_ostta15g01360 Help Entry OT_ostta15g01360  CDS       T01358                                  Name (RefSeq) TFIIH subunit TTDA/Tfb5   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism ota  Ostreococcus tauri Pathway ota03022   Basal transcription factors ota03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ota00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     OT_ostta15g01360   09124 Replication and repair    03420 Nucleotide excision repair     OT_ostta15g01360  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ota03021]     OT_ostta15g01360    03400 DNA repair and recombination proteins [BR:ota03400]     OT_ostta15g01360 Transcription machinery [BR:ota03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      OT_ostta15g01360 DNA repair and recombination proteins [BR:ota03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      OT_ostta15g01360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  9830861 NCBI-ProteinID:  XP_003083281 OrcAE:  OT_ostta15g01360 UniProt:  Q00V71 LinkDB All DBs Position 15:complement(234862..235089) Genome browser AA seq 75 aa AA seqDB search MVSAVHGVMLTTDVPIKQYVLHLDAIAPAEGKFVIADLDERRVLIQPERAEQVKREIERY QQTTQYVAPNAMSKQ NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggtctccgccgtccacggcgtcatgctcaccaccgacgtcccgatcaagcagtacgtt ctccacctcgacgccatcgcccccgccgagggcaagttcgtcatcgccgacctggacgag cgcagagtgttgattcaaccggagcgcgcggagcaagtcaagcgagagatcgagcggtac caacagacgacgcaatacgtcgcgccgaacgcgatgagcaagcagtga

DBGET integrated database retrieval system