KEGG   Onychostruthus taczanowskii (white-rumped snowfinch): 121337554
Entry
121337554         CDS       T07590                                 
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
otc  Onychostruthus taczanowskii (white-rumped snowfinch)
SSDB
Motif
Pfam: MRAP ABC2_membrane_4 PAG
Other DBs
NCBI-GeneID: 121337554
NCBI-ProteinID: XP_041263629
LinkDB
Position
Unknown
AA seq 143 aa
MANRTNSSEYFWSYEYYWDYIDPIPVDGSKLKVNKYSIVIAFWVGLAAFVTFLFLILLCM
SCSGSTPAKALSSPWSLLLSSGIPLEFTVLLIICFTCQCLGLSTSRPAVRLXRHLLLIPS
STATNGSAGSGRSSLGSDCTRAN
NT seq 432 nt   +upstreamnt  +downstreamnt
atggctaacagaacaaactcctctgagtatttctggtcttatgaatattactgggattac
atagatccaattccagtagatggaagcaagttgaaggttaataaatactccatcgtcatc
gccttctgggtgggcctcgctgccttcgtgacgtttcttttccttattctgctctgtatg
tcctgctctggatccacgccagcaaaggctctgagctctccctggagccttctcctctcc
agtggaattcctctggaatttacggttctactaattatttgtttcacctgtcagtgtctg
ggtttgtctaccagcagacccgcagttcgtttgtaaagacacctccttctcattccttcc
agcacggccacgaacgggagcgcggggtcgggcaggagctcattaggcagtgactgcact
cgcgctaattaa

DBGET integrated database retrieval system