KEGG   Ottowia oryzae: C6570_03215
Entry
C6570_03215       CDS       T05363                                 

Name
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K20937  1-butanol dehydrogenase (quinone) [EC:1.1.5.11]
Organism
otk  Ottowia oryzae
Brite
KEGG Orthology (KO) [BR:otk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C6570_03215
Enzymes [BR:otk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.11  1-butanol dehydrogenase (quinone)
     C6570_03215
SSDB
Motif
Pfam: PQQ PQQ_2 PQQ_3 ANAPC4_WD40
Other DBs
NCBI-ProteinID: AVO33372
UniProt: A0A2S0MBU2
LinkDB
Position
682585..684444
AA seq 619 aa
MRLNTLCLAIAATVSLPAFAVKPVTWEDIANDAKTTEDVLSYGLGLTAQRYSPLKTLNPK
NVAGLVPAWSYSFGGEKQRGQEAQALVHDCVVYVTASYSRFVAIDARTGKRLWTYEHRLP
EDIRPCCDVVNRGPAIYGDKVYFGTLDARVIALDRATGKVVWNEKFGDHKVGYTMTGAPF
IIKDKQTGKVLLVHGSSGDEFGVVGYLYARDPDTGKEIWARPLVEGHVGRLNGQPSTPTG
DPKAPTWPNDPNSPTGKAEAWSQGGGAPWQTPSFDVETNTIIVGTGNPAPWNTWKRTAKG
DDPRNWPSLYTSGQAYIDPTTGDLKGFFSHTPNDAWDFSGNNSVLLFDYKDKTTGKTVKA
SAHADRNGFFFVTDREKLAKADGGHPWKQNAIINAWPFVDGITWASGFDLKTGLPNEKGN
RPPEPKEGQEKGDSVFVSPPFLGGTNWMPMSYSPDTGLFYIPANHWAMDYWSEQITYKAG
AAYLGQGFRIKKLYDDHVGILRAINPQTGKIAWEHKEQFPLWAGTLTTGGGLLFTGTSDG
YVKAFDAKNGKELWKFQTGSGVVSVPITWQMDGEQYVGIQSGYGGAVPLWGGDMAELTKQ
VTQGGSMWVFKLPKQVASR
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgcgtttgaacacgctgtgtctggcgattgcagccaccgtcagtcttcccgcgttcgcg
gtcaagccagtgacctgggaagacattgcaaacgacgccaagaccaccgaagacgtgctg
tcctatggattagggctgacggcccaacgctacagcccgctgaagacgctgaaccccaag
aacgtggcaggccttgttccggcgtggagctactcctttggcggagagaagcagcgcggc
caggaggcacaggcgctcgtgcacgactgtgtggtgtatgtgacagcctcctactcgcgc
ttcgtggcgatcgacgcgcgcaccggcaagcgcctctggacctatgagcaccgactgccg
gaggatatccggccgtgctgcgacgtggtcaatcgcggacctgcgatctacggcgacaag
gtgtatttcggtacgctcgatgcgcgcgtgatcgctttggaccgcgcgaccggcaaagtc
gtgtggaacgagaagttcggcgaccacaaggtgggctacaccatgaccggtgcgcccttc
atcatcaaggacaagcagaccggcaaggtgctgctggtgcatggatcgtctggcgacgaa
ttcggtgtggtgggctatctctacgcgcgagaccccgacaccggcaaggagatctgggca
cgaccactggtggaaggccatgtgggtcgattgaacggtcagcccagcacgcctacaggc
gatcccaaggcgccgacctggccgaacgaccccaattcccccaccggcaaggcggaggcc
tggagccaggggggcggtgcgccgtggcaaacaccgtcgttcgacgtggagaccaacacc
atcatcgtgggtaccggcaacccagcgccttggaacacctggaagcgcacggccaagggt
gacgacccgcgcaactggcccagcctgtacacctcgggtcaggcctacatcgatccgacg
actggcgacctcaaggggttcttctcgcatacgcccaacgacgcctgggatttctccggc
aacaactccgtgctcctgttcgattacaaggacaagacgaccggcaagactgtcaaggca
tctgcccacgccgaccgcaatggctttttcttcgtgaccgaccgcgagaaactcgccaaa
gccgacggtggtcatccttggaagcagaacgccatcatcaatgcctggcccttcgtggac
ggcatcacctgggcctcgggctttgacctcaagaccggccttcccaatgagaagggcaat
cgtccgcccgagcccaaggaaggtcaggagaagggcgacagcgtcttcgtttcgccaccg
ttccttggcggcaccaactggatgccgatgagctatagccccgacaccggtttgttctac
atcccggccaatcactgggccatggactactggtccgagcagatcacgtacaaggcgggc
gcagcgtacttgggtcagggctttcgcatcaagaagctgtacgacgaccatgtcggcatc
ctgcgcgccatcaatccgcagaccggcaagatcgcatgggaacacaaagagcagtttccg
ctgtgggccggcacgctcactaccggcggcggccttttgttcaccgggacatctgacggt
tacgtgaaagccttcgatgccaagaacgggaaggagctgtggaagtttcagaccggatcg
ggcgtggtttccgttccgatcacgtggcagatggatggcgagcagtatgtgggcatccag
tcgggctacggcggcgcggtgccactctggggcggcgacatggctgagctgaccaagcag
gtcacgcagggtggatcgatgtgggtgttcaagctgcccaagcaagtggccagcaggtaa

DBGET integrated database retrieval system