KEGG   Onthophagus taurus (bull-headed dung beetle): 111425068
Entry
111425068         CDS       T07420                                 
Name
(RefSeq) cytochrome P450 306a1-like isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
otu  Onthophagus taurus (bull-headed dung beetle)
Pathway
otu00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:otu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    111425068
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:otu00199]
    111425068
Enzymes [BR:otu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     111425068
Cytochrome P450 [BR:otu00199]
 Cytochrome P450, animal type
  CYP306 family
   111425068
SSDB
Motif
Pfam: p450 DUF22 DASH_Dad3 TRAPP
Other DBs
NCBI-GeneID: 111425068
NCBI-ProteinID: XP_022914599
LinkDB
Position
Unknown
AA seq 564 aa
MINGILCKVSSYPTNDRSNAKGELLLLLRVGSSDHARLAWILQRAVKPRGCISVNLNCQE
CQLEMIYFLVAFIVILLGFYWKKPKNTPPGPFGLPVVGYLPWLDPVNPHLTLTQLSKKFG
SVYGLFLGSVYTVVVSDHKIIRKLFAKEATIGRAPLYLTHGIMKGYGIICSEKDLWKDQR
KFVFSCFKQFGMSKIGGKRETMQSFILKEVNDLIDYIKHSKPTSNGDIILDPNHILKHNV
GSTVHEIVFGTSYNRDDKIWNYLLHLQEEGTKCLGIAGPLNFLPFLRFLPSFKKSMAFIT
DGQAETHEEYKKIISKQKTLLNQFLENDPNYQPDNILHAFLMEKEKRKGEPTEKFYNPTQ
LLYLLADIFGAGLDTTLTTLRWFFLYMAKHPEIQKKLHEEIDNIIQNRSPNLNDFASMPF
AEACFSETQRIRSVVPVGIPHGALEDVQIENYVIPENTMIVPLQWAIHMDEEVWDSPEEF
NPNRFLNEEGGFVKNEALIPFQTGKRMCVGDEFARMVMFLFGVGVLQEFFVCAPDGIDLD
VTGDCGITLTPKDHELVFKVRKIV
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgatcaatggtatcttgtgcaaggtgtcctcatatcccacaaatgatcgatcaaatgcc
aagggagaattactactccttcttcgtgtaggaagttctgaccatgctcgtttagcctgg
atattacaacgggctgtaaaacctcgtggatgcatcagtgtgaatttaaactgccaggaa
tgccaactagagatgatttactttcttgtagctttcatcgtaattctattaggattttat
tggaagaagcccaaaaatactcccccaggaccctttggattaccagtcgttggatattta
ccgtggttagatccagtaaatccccacttaactttaacacaactcagcaaaaaattcggc
agcgtttatgggttgtttttaggatcggtttatacagtggttgtttctgatcataaaata
ataaggaagttattcgctaaagaagctacaattggaagagcacctctctatttaacccat
ggaattatgaaaggatatggaattatttgctcggaaaaggatttgtggaaagatcaaaga
aaattcgtttttagttgttttaaacaattcggaatgtcgaaaattggcggtaaacgggaa
acgatgcaatcattcattttaaaggaagtaaacgatctcattgattatattaaacattct
aaaccaacgtcaaatggtgatatcatcttagacccaaatcatattttaaaacataacgta
ggatcaactgttcatgaaatcgtttttgggacttcttataatcgagatgacaaaatttgg
aattatttacttcatcttcaagaagaaggtacgaaatgtcttggaattgctggaccttta
aattttcttcctttcttaagatttcttccatctttcaaaaaatcaatggcatttataaca
gatggccaagctgaaactcacgaagaatataaaaagataatctccaaacaaaaaactctc
ttaaatcaattccttgaaaacgatccaaattatcaaccagataatattttgcacgccttt
ttaatggaaaaagagaaacgaaaaggagaaccaacagaaaaattttacaaccccactcaa
ctcctttatttactagcggatatcttcggagccggcttagatacaaccctcaccacttta
agatggttcttcttgtacatggccaaacacccggaaattcaaaaaaaactccacgaagaa
atcgacaacatcattcaaaacagatctccgaatctaaacgattttgcatcgatgcctttc
gctgaggcgtgcttctccgaaactcaaagaatccgatccgtagttccggttggaatccct
cacggtgctttggaagacgttcaaatcgaaaattacgttatcccagaaaacacgatgatt
gtcccattacaatgggctatccatatggatgaggaggtttgggatagcccagaagagttt
aatccaaatcgatttttaaacgaggaaggaggtttcgttaaaaacgaagctttaattccg
tttcaaaccgggaaaaggatgtgtgttggggatgagtttgctcggatggttatgttttta
tttggagttggtgttttgcaagagttttttgtttgtgctccggatggaatcgatttggat
gttactggagattgtggcatcactttaacaccgaaagaccatgagttagtttttaaggta
agaaaaattgtttaa

DBGET integrated database retrieval system