KEGG   Pyrococcus abyssi: PAB0289
Entry
PAB0289           CDS       T00024                                 

Gene name
leuB-2
Definition
(GenBank) leuB-2 3-isopropylmalate dehydrogenase
  KO
K17753  isocitrate--homoisocitrate dehydrogenase [EC:1.1.1.286]
Organism
pab  Pyrococcus abyssi
Pathway
pab00020  Citrate cycle (TCA cycle)
pab00300  Lysine biosynthesis
pab01100  Metabolic pathways
pab01110  Biosynthesis of secondary metabolites
pab01120  Microbial metabolism in diverse environments
pab01210  2-Oxocarboxylic acid metabolism
pab01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAB0289 (leuB-2)
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PAB0289 (leuB-2)
Enzymes [BR:pab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.286  isocitrate---homoisocitrate dehydrogenase
     PAB0289 (leuB-2)
SSDB
Motif
Pfam: Iso_dh LPD7
Other DBs
NCBI-ProteinID: CAB49361
UniProt: Q9V1I8
LinkDB
Position
422356..423396
AA seq 346 aa
MYRVAVIKGDGIGPEVVDSAIRVVNSVTDRIRFYEFEGGFEVFKRIGSPISEDDLKEIRK
MDAILFGATTTPFNVPGYRSLIVTLRKELDLYANLRIIPDLSNGKEIVIVRENTEGLYAR
DGIGFSDRAIDFRIITLEGARRIAKFAINLAKERNSFITFVHKANVLKGDRFFREIVLEI
AEREGVEVREAIIDSFMIKLVKNPWDHGVILTENMFGDIISDLATIHAGSIGIVPSGNYG
DEIALFEPIHGSAPDIAGKGIANPIGAILSAAMMLDYLGLNGKVVWEATRRYVRYGNLTP
DMGGTATTSEVTKGIISEIYSFDPFDIDEIWVEEIRLGRIPLTLWR
NT seq 1041 nt   +upstreamnt  +downstreamnt
gtgtatagggtagccgtgattaagggtgacggaatagggcctgaggttgtagattcagcg
attagggtggttaattccgtaacggataggataaggttctatgaattcgagggaggattc
gaggtattcaagagaattggctcgccgataagtgaggatgacctgaaagagataaggaag
atggatgccatattgtttggagcaacaaccacaccctttaacgttcctgggtataggagt
ttgatagtaaccctcaggaaggagctcgacctttatgcaaaccttaggattatcccggat
ttaagcaacggtaaggagatagttatagttagggaaaacaccgagggattgtacgcaagg
gacgggataggattcagtgatagagccattgatttcaggataataacccttgaaggggct
agaaggatagcaaaatttgccattaacttggctaaggaaaggaactccttcataactttc
gttcataaggcgaacgtgttgaagggtgacagattcttcagggagatagttctggagatt
gctgaaagggaaggggtggaagttagggaagctataatcgattctttcatgattaagtta
gtcaagaacccctgggaccacggggttatattaaccgagaacatgtttggggatataatt
tccgacctagcaactatccatgctggaagcataggaatagttccaagtggcaactatgga
gatgaaatagcgctctttgagcccatccacggttccgcaccggatatagctgggaagggg
atagcaaatccaattggagctattctaagcgcagccatgatgctcgactatctggggctt
aacggtaaggtagtatgggaggccaccaggaggtacgtgaggtacggtaatctaaccccc
gatatgggtggaactgcaacgactagcgaagttactaagggaataatctcggaaatttat
tcttttgatccctttgacatagatgaaatctgggttgaagagatcaggcttgggagaatt
cctctaacactttggaggtga

DBGET integrated database retrieval system