KEGG   Pyrococcus abyssi: PAB1445
Entry
PAB1445           CDS       T00024                                 

Definition
(GenBank) ptpS-like 6-pyruvoyl-tetrahydropterin synthase
  KO
K22102  dihydroneopterin phosphate aldolase [EC:4.1.2.59]
Organism
pab  Pyrococcus abyssi
Pathway
pab00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAB1445
Enzymes [BR:pab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.59  dihydroneopterin phosphate aldolase
     PAB1445
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-ProteinID: CAB50312
UniProt: Q9UYV0
LinkDB
Position
complement(1362223..1362570)
AA seq 115 aa
MRARIIVRTSFDAAHAVKIGDDWESLHGHTFFLEVAVEGEIKRGYIMDFTELRKIVDDIV
KELNHRNLNKIFDNPTTENVALWIAEKVEEKLPHKVKLKRVVLWEGKDNGVELEW
NT seq 348 nt   +upstreamnt  +downstreamnt
atgagggcaaggataatagttaggacgagttttgatgctgcacatgccgttaagataggt
gacgactgggaaagtcttcatggccacacgttctttctcgaggtggccgttgagggagaa
ataaagaggggttacataatggactttacggagcttaggaagatagtcgatgatatagtt
aaggaacttaaccacaggaacttgaacaagatattcgacaatccaactaccgaaaacgtg
gcactttggatagctgagaaagttgaagagaagcttccccacaaggtcaagctgaagagg
gtagttctttgggaagggaaagataatggggtggagctggagtggtaa

DBGET integrated database retrieval system