Syntrophotalea acetylenica: A6070_05345 Help Entry A6070_05345       CDS       T04585                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism pace  Syntrophotalea acetylenica Pathway pace00400   Phenylalanine, tyrosine and tryptophan biosynthesis pace01100   Metabolic pathways pace01110   Biosynthesis of secondary metabolites pace01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:pace00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     A6070_05345 Enzymes [BR:pace01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      A6070_05345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  APG43610 UniProt:  A0A1L3GHW9 LinkDB All DBs Position 1185978..1186250 Genome browser AA seq 90 aa AA seqDB search MTIDEIRQRIDALDDELLKIFNCRAGLALAIGELKKAEGRAVYDPKREQMIFERMKATNP GPLDDGAIVRLFERVIDETRRLERIRTKGE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgacaatcgatgaaatcaggcagcggattgacgctctcgatgacgaacttctcaaaata ttcaattgccgggcggggctggccctcgccatcggcgagctcaaaaaagccgaagggcgg gcggtctatgaccccaaaagggaacagatgatttttgagcgtatgaaggcgaccaatccc ggtccgctcgacgatggtgccattgtccggttgttcgagcgtgtcatcgatgagaccagg cggttggagcgtatccggacgaagggagagtaa

DBGET integrated database retrieval system