KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_1032
Entry
N296_1032         CDS       T03170                                 
Symbol
pqsD
Name
(GenBank) PQB biosynthetic 3-oxoacyl-[acyl-carrier-protein] synthase III
  KO
K18003  anthraniloyl-CoA anthraniloyltransferase [EC:2.3.1.262]
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Pathway
paei00405  Phenazine biosynthesis
paei01110  Biosynthesis of secondary metabolites
paei02024  Quorum sensing
paei02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:paei00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    N296_1032 (pqsD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    N296_1032 (pqsD)
   02025 Biofilm formation - Pseudomonas aeruginosa
    N296_1032 (pqsD)
Enzymes [BR:paei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.262  anthraniloyl-CoA anthraniloyltransferase
     N296_1032 (pqsD)
SSDB
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N Chal_sti_synt_N SpoVAD
Other DBs
NCBI-ProteinID: AGY67383
LinkDB
Position
1081942..1082955
AA seq 337 aa
MGNPILAGLGFSLPKRQVSNHDLVGRINTSDEFIVERTGVRTRYHVEPEQAVSALMVPAA
RQAIEAAGLLPEDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQCSGLLYGL
QMARGQILAGLARHVLVVCGEVLSKRMDCSDRGRNLSILLGDGAGAVVVSAGESLEDGLL
DLRLGADGNYFDLLMTAAPGSASPTFLDENVLREGGGEFLMRGRPMFEHASQTLVRIAGE
MLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDRLGNMASASTPVTLAM
FWPDIQPGQRVLVLTYGSGATWGAALYRKPEEVNRPC
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgggtaatccgatcctggccgggctgggtttcagcctgccgaaacgccaggtcagcaat
catgacctggtagggcgcatcaatacgtcggacgagttcatcgtcgaacgtaccggcgtg
cgcacccgctatcacgtcgagccggaacaggcggtcagcgcgctgatggtgccggcggcg
cgccaggccatcgaggctgccgggctgctgccggaggacatcgacctgttgctggtgaac
accctgtcgccggaccaccacgacccgtcccaggcctgcctgatccagccgctgctgggc
ctgcggcacatcccggtactggatatccgggcacagtgcagcgggttgctgtacggcttg
cagatggctcgcgggcagatcctcgccgggctggcacggcatgtcctggtggtctgcggc
gaggtgctgtccaagcgcatggactgttcggaccgcggccgcaacctgtcgatcctgctc
ggcgacggtgccggcgcagtggtggtcagcgccggcgagagtctcgaagacggactgctg
gacctgcgcctgggcgccgacggcaactacttcgacctgctgatgaccgcggcgccgggt
agtgcctcgccgaccttcctcgacgagaatgtcctgcgcgagggcgggggcgagttcctc
atgcgcggccggccgatgttcgagcatgccagccagaccctggtacggatcgccggcgaa
atgctcgcggcccatgagctgaccctggacgacatcgaccatgtgatctgccatcaaccg
aacctgcgcatcctcgatgcggtgcaggagcaactgggcattccccagcacaagttcgcg
gtgaccgtggatcgtctgggcaacatggcttcggcctcgaccccggtcacgctggcgatg
ttctggccggacatccagccgggacagcgggtgctggtcctgacctacggctccggcgcg
acctggggcgcggcgctgtaccgcaaacctgaggaggtgaaccggccatgttga

DBGET integrated database retrieval system