KEGG   Pseudomonas aeruginosa PA1: PA1S_20975
Entry
PA1S_20975        CDS       T02928                                 
Name
(GenBank) 3-oxoacyl-ACP synthase
  KO
K18003  anthraniloyl-CoA anthraniloyltransferase [EC:2.3.1.262]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00405  Phenazine biosynthesis
paep01110  Biosynthesis of secondary metabolites
paep02024  Quorum sensing
paep02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    PA1S_20975
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA1S_20975
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA1S_20975
Enzymes [BR:paep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.262  anthraniloyl-CoA anthraniloyltransferase
     PA1S_20975
SSDB
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N Chal_sti_synt_N SpoVAD
Other DBs
NCBI-ProteinID: AHA20503
LinkDB
Position
complement(4504680..4505693)
AA seq 337 aa
MGNPILAGLGFSLPKRQVSNHDLVGRINTSDEFIVERTGVRTRYHVEPEQAVSALMVPAA
RQAIEAAGLLPEDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQCSGLLYGL
QMARGQILAGLARHVLVVCGEVLSKRMDCSDRGRNLSILLGDGAGAVVVSAGESLDDGLL
DLRLGADGNYFDLLMTAAPGSASPTFLDENVLREGGGEFLMRGRPMFEHASQTLVRIAGE
MLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDRLGNMASASTPVTLAM
FWPDIQPGQRVLVLTYGSGATWGAALYRKPEEVNRPC
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgggtaatccgatcctggccgggctgggtttcagcctgccgaaacgccaggtcagcaat
catgacctggtagggcgcatcaatacgtcggacgagttcatcgtcgaacgtaccggcgtg
cgcacccgctatcacgtcgagccggaacaggcggtcagcgcgctgatggtgccggcggcg
cgccaggccatcgaggctgccgggctgctgccggaggacatcgacctgttgctggtgaac
accctgtcgccggatcaccacgacccgtcccaggcctgcctgatccagccgctgctgggc
ctgcggcacatcccggtgctggatatccgggcacagtgcagcgggttgctgtacggcttg
cagatggctcgcgggcagatcctcgccgggctggcacggcatgtcctggtggtctgcggc
gaggtgctgtccaagcgcatggactgttcggaccgcggccgcaacctgtcgatcctgctc
ggcgacggtgccggcgcagtggtggtcagcgccggcgagagcctcgacgacggcctgctg
gacctgcgcctgggcgccgacggcaactacttcgacctgctgatgactgcggcgccgggc
agtgcctcgccgaccttcctcgacgagaatgtcctgcgcgagggcgggggcgagttcctc
atgcgcggccggccgatgttcgagcatgccagccagaccctggtacggatcgccggcgaa
atgctcgcggcccatgagctgaccctggacgacatcgaccatgtgatctgccatcaaccg
aacctgcgcatcctcgatgcggtgcaggagcaactgggcattccccagcacaagttcgcg
gtgaccgtggatcgtctgggcaacatggcttcggcctcgaccccggtcacgctggcgatg
ttctggccggacatccagccgggacagcgggtgctggtcctgacctacggctccggcgcg
acctggggcgcggcgctgtaccgcaaacctgaggaggtgaaccggccatgttga

DBGET integrated database retrieval system