KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_4443
Entry
SCV20265_4443     CDS       T02971                                 
Name
(GenBank) PQS biosynthesis protein PqsD, similar to 3-oxoacyl-[acyl-carrier-protein] synthase III
  KO
K18003  anthraniloyl-CoA anthraniloyltransferase [EC:2.3.1.262]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00405  Phenazine biosynthesis
paes01110  Biosynthesis of secondary metabolites
paes02024  Quorum sensing
paes02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SCV20265_4443
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SCV20265_4443
   02025 Biofilm formation - Pseudomonas aeruginosa
    SCV20265_4443
Enzymes [BR:paes01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.262  anthraniloyl-CoA anthraniloyltransferase
     SCV20265_4443
SSDB
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N Chal_sti_synt_N SpoVAD
Other DBs
NCBI-ProteinID: AHC78551
LinkDB
Position
complement(4710183..4711196)
AA seq 337 aa
MGNPILAGLGFSLPKRQVSNHDLVGRINTSDEFIVERTGVRTRYHVEPEQAVSALMVPAA
RQAIEAAGLLPEDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQCSGLLYGL
QMARGQILAGLARHVLVVCGEVLSKRMDCSDRGRNLSILLGDGAGAVVVSAGESLDDGLL
DLRLGADGNYFDLLMTAAPGSASPTFLDENVLREGGGEFLMRGRPMFEHASQTLVRIAGE
MLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDRLGNMASASTPVTLAM
FWPDIQPGQRVLVLTYGSGATWGAALYRKPEEVNRPC
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgggtaatccgatcctggccgggctgggtttcagcctgccgaaacgccaggtcagcaat
catgacctggtagggcgcatcaatacgtcggacgagttcatcgtcgaacgtaccggcgtg
cgcacccgctatcacgtcgagccggaacaggcggtcagcgcgctgatggtgccggcggcg
cgccaggccatcgaggctgccgggctgctgccggaggacatcgacctgttgctggtgaac
accctgtcgccggaccaccacgacccgtcccaggcctgcctgatccagccgctgctgggc
ctgcggcacatcccggtgctggatatccgggcacagtgcagcgggttgctgtacggcttg
cagatggctcgcgggcagatcctcgccgggctggcacggcatgtcctggtggtctgcggc
gaggtgctgtccaagcgcatggactgttcggaccgcggccgcaacctgtcgatcctgctc
ggcgacggtgccggcgcagtggtggtcagcgccggcgagagcctcgacgacggcctgctg
gacctgcgcctgggcgccgacggcaactacttcgacctgctgatgactgcggcgccgggc
agtgcctcgccgaccttcctcgacgagaatgtcctgcgcgagggcgggggcgagttcctc
atgcgcggccggccgatgttcgagcatgccagccagaccctggtacggatcgccggcgaa
atgctcgcggcccatgagctgaccctggacgacatcgaccatgtgatctgccatcaaccg
aacctgcgcatcctcgatgcggtacaggagcaactgggcattccccagcacaagttcgcg
gtgaccgtggatcgtctgggcaacatggcttcggcctcgaccccggtcacgctggcgatg
ttctggccggacatccagccgggacagcgggtgctggtcctgacctacggctccggcgcg
acctggggcgcggcgctgtaccgcaaacctgaggaggtgaaccggccatgttga

DBGET integrated database retrieval system