KEGG   Pseudomonas aeruginosa PA38182: BN889_01051
Entry
BN889_01051       CDS       T03031                                 
Symbol
pqsD
Name
(GenBank) 3-oxoacyl-ACP synthase
  KO
K18003  anthraniloyl-CoA anthraniloyltransferase [EC:2.3.1.262]
Organism
paeu  Pseudomonas aeruginosa PA38182
Pathway
paeu00405  Phenazine biosynthesis
paeu01110  Biosynthesis of secondary metabolites
paeu02024  Quorum sensing
paeu02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BN889_01051 (pqsD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BN889_01051 (pqsD)
   02025 Biofilm formation - Pseudomonas aeruginosa
    BN889_01051 (pqsD)
Enzymes [BR:paeu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.262  anthraniloyl-CoA anthraniloyltransferase
     BN889_01051 (pqsD)
SSDB
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N Chal_sti_synt_N SpoVAD
Other DBs
NCBI-ProteinID: CDI89118
UniProt: A0A8D9JFS6
LinkDB
Position
1121803..1122816
AA seq 337 aa
MGNPILAGLGFSLPKRQVSNHDLVGRINTSDEFIVERTGVRTRYHVEPEQAVSALMVPAA
RQAIEAAGLLPEDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQCSGLLYGL
QMARGQILAGLARHVLVVCGEVLSKRMDCSDRGRNLSILLGDGAGAVVVSAGESLDDGLL
DLRLGADGNYFDLLMTAAPGSASPTFLDENVLREGGGEFLMRGRPMFEHASQTLVRIAGE
MLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDRLGNMASASTPVTLAM
FWPDIQPGQRVLVLTYGSGATWGAALYRKPEEVNRPC
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgggtaatccgatcctggccgggctgggtttcagcctgccgaaacgccaggtcagcaat
catgacctggtagggcgcatcaatacgtcggacgagttcatcgtcgaacgtaccggcgtg
cgcacccgctatcacgtcgagccggaacaggcggtcagcgcgctgatggtgccggcggcg
cgccaggccatcgaggctgccgggctgctgccggaggacatcgacctgttgctggtgaac
accctgtcgccggaccaccacgacccgtcccaggcctgcctgatccagccgctgctgggc
ctgcggcacatcccggtactggatatccgggcacagtgcagcgggttgctgtacggcttg
cagatggctcgcgggcagatcctcgccgggctggcacggcatgtcctggtggtctgcggc
gaggtgctgtccaagcgcatggactgttcggaccgcggccgcaacctgtcgatcctgctc
ggcgacggtgccggcgcagtggtggtcagcgccggcgagagcctcgacgacggcctgctg
gacctgcgcctgggcgccgacggcaactacttcgacctgctgatgactgcggcgccgggc
agtgcctcgccgaccttcctcgacgagaatgtcctgcgcgagggcgggggcgagttcctc
atgcgcggccggccgatgttcgagcatgccagccagaccctggtacggatcgccggcgaa
atgctcgcggcccatgagctgaccctggacgacatcgaccatgtgatctgccatcaaccg
aacctgcgcatcctcgatgcggtgcaggagcaactgggcattccccagcacaagttcgcg
gtgaccgtggatcgtctgggcaacatggcttcggcctcgaccccggtcacgctggcgatg
ttctggccggacatccagccgggacagcgggtgctggtcctgacctacggctccggcgcg
acctggggcgcggcgctgtaccgcaaacctgaggaggtgaaccggccatgttga

DBGET integrated database retrieval system