Pteropus alecto (black flying fox): 107196088 Help Entry 107196088         CDS       T02993                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism pale  Pteropus alecto (black flying fox) Pathway pale01521   EGFR tyrosine kinase inhibitor resistance pale04010   MAPK signaling pathway pale04014   Ras signaling pathway pale04015   Rap1 signaling pathway pale04020   Calcium signaling pathway pale04151   PI3K-Akt signaling pathway pale04550   Signaling pathways regulating pluripotency of stem cells pale04810   Regulation of actin cytoskeleton pale05167   Kaposi sarcoma-associated herpesvirus infection pale05200   Pathways in cancer pale05205   Proteoglycans in cancer pale05207   Chemical carcinogenesis - receptor activation pale05218   Melanoma pale05224   Breast cancer pale05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107196088 (FGF2)    04014 Ras signaling pathway     107196088 (FGF2)    04015 Rap1 signaling pathway     107196088 (FGF2)    04020 Calcium signaling pathway     107196088 (FGF2)    04151 PI3K-Akt signaling pathway     107196088 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     107196088 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     107196088 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107196088 (FGF2)    05205 Proteoglycans in cancer     107196088 (FGF2)    05207 Chemical carcinogenesis - receptor activation     107196088 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     107196088 (FGF2)    05218 Melanoma     107196088 (FGF2)    05224 Breast cancer     107196088 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     107196088 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     107196088 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     107196088 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:pale00536]     107196088 (FGF2) Cytokines and neuropeptides [BR:pale04052]  Cytokines   Growth factors (RTK binding)    107196088 (FGF2) Glycosaminoglycan binding proteins [BR:pale00536]  Heparan sulfate / Heparin   Growth factors/receptors    107196088 (FGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  107196088 NCBI-ProteinID:  XP_015449380 LinkDB All DBs Position Unknown AA seq 145 aa AA seqDB search ALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERG VVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRT GQYKLGPKTGPGQKAILFLPMSAKS NT seq 438 nt NT seq  +upstreamnt  +downstreamnt gccctgccggaggacggcggcagcggcgccttcccgcccggccacttcaaggaccccaaa cggctgtactgcaagaacgggggcttcttcctgcgcatccaccccgacggccgcgtggac ggggtccgggagaagagcgaccctcacatcaaactacaactgcaagcagaggagagaggg gtcgtgtccatcaagggagtgtgtgcgaaccgctatctcgccatgaaggaggatggacgg ctgctggcttccaaatgtgttacggacgagtgtttcttttttgaacgactggagtctaat aactacaatacttaccggtcaaggaaatactccagttggtacgtggcattgaaacgaact gggcagtataaacttggacccaaaacaggccctgggcagaaagctatactttttcttcca atgtctgctaagagctga

DBGET integrated database retrieval system