KEGG   Pseudomonas alcaliphila: UYA_07100
Entry
UYA_07100         CDS       T06680                                 
Name
(GenBank) benzene 1,2-dioxygenase
  KO
K08689  biphenyl 2,3-dioxygenase subunit alpha [EC:1.14.12.18]
Organism
pall  Pseudomonas alcaliphila
Pathway
pall00621  Dioxin degradation
pall01100  Metabolic pathways
pall01120  Microbial metabolism in diverse environments
pall01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pall00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    UYA_07100
Enzymes [BR:pall01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     UYA_07100
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: APU29506
UniProt: D3WHI7
LinkDB
Position
complement(1555714..1557090)
AA seq 458 aa
MSSSIKEVQGAPVKWVTNWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLL
LGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTC
SYHGWAYDIAGKLVNVPFEKEAFCDKKEGDCGFDKAEWGPLQARVATYKGLVFANWDVQA
PDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTMSHL
SGILAGMPPEMDLSHAQVPTKGNQFRAGWGGHGSGWFVDEPGMLMAVMGPKVTQYWTEGP
AADLAEQRLGHTMPVRRMFGQHMSVFPTCSFLPAINTIRTWHPRGPNEIEVWAFTLVDAD
APAEIKEEYRRHNIRTFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTG
HPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgagctcatcaatcaaagaagtgcagggagcccctgtgaagtgggttaccaattggacg
ccggaggcgatccgggggttggtcgatcaggaaaaagggctgcttgatccacgcatctac
gccgatcagagtctttatgagctggagcttgagcgggtttttggtcgctcttggctgtta
cttgggcacgagagtcatgtgcctgaaaccggggacttcctggccacttacatgggcgaa
gatccggtggttatggtgcgacagaaagacaagagcatcaaggtgttcctgaaccagtgc
cggcaccgcggcatgcgtatctgccgctcggacgccggcaacgccaaggctttcacctgc
agctatcacggctgggcctacgacatcgccggcaagctggtgaacgtgccgttcgagaag
gaagccttttgcgacaagaaagaaggcgactgcggctttgacaaggccgaatggggcccg
ctccaggcacgcgtggcaacctacaagggcctggtctttgccaactgggatgtgcaggcg
ccagacctggagacctacctcggtgacgcccgcccctatatggacgtcatgctggatcgc
acgccggccgggactgtggccatcggcggcatgcagaagtgggtgattccgtgcaactgg
aagtttgccgccgagcagttctgcagtgacatgtaccacgccggcaccatgtcgcacctg
tccggcatcctggcgggcatgccgccggaaatggacctgtcgcatgcacaggtgcccacc
aagggcaaccagttccgggccggctggggcgggcacggctcgggctggttcgtcgacgag
ccgggcatgctcatggcggtgatggggcccaaggtcacccagtactggaccgaaggtccg
gctgccgacctggcagaacagcgactgggccacaccatgccggttcgacgcatgttcggc
cagcacatgagcgtcttcccgacctgctcgttcctcccggccatcaacaccatccggacc
tggcacccgcgcggccccaacgaaatcgaagtgtgggccttcaccttggtcgatgccgat
gccccggccgagatcaaggaagaatatcgccggcacaacatccgcaccttctccgcaggc
ggcgtgtttgagcaggacgatggcgagaactgggtggagatccagaaggggctacgtggg
tacaaggccaagagccagccgctcaatgcccagatgggcctgggtcggtcgcagaccggt
caccctgattttcctggcaacgtcggctacgtctacgccgaagaagcggcgcggggtatg
tatcaccactggatgcgcatgatgtccgagcccagctgggccacgctcaagccctga

DBGET integrated database retrieval system